KEGG   Oryctolagus cuniculus (rabbit): 100355829
Entry
100355829         CDS       T03373                                 

Gene name
SIAH1
Definition
(RefSeq) siah E3 ubiquitin protein ligase 1
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100355829 (SIAH1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100355829 (SIAH1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100355829 (SIAH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100355829 (SIAH1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100355829 (SIAH1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    100355829 (SIAH1)
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 100355829
NCBI-ProteinID: XP_002721389
Ensembl: ENSOCUG00000004814
UniProt: U3KP05
LinkDB
Position
Un
AA seq 313 aa
MTGKPTLPFLYSWRGVLLTCFPAGRTRKRKEMSRQTATALPTGTSKCPPSQRVPALTGTT
ASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEK
VANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLM
HQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIV
QLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAE
NGNLGINVTISMC
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaccggaaagcccaccctaccttttctgtactcctggaggggagtcttgctcacatgt
ttcccagcgggtaggacaaggaagagaaaagaaatgagccgtcagactgctactgcatta
ccgactggtacctcgaagtgcccgccgtcgcagagggtgcctgccctgacgggcacgacc
gcgtccaacaatgacttggcgagtctttttgagtgtccggtctgctttgactatgtgttg
ccacccattcttcagtgtcagagtggccatctcgtttgtagcaactgtcgcccaaagctc
acatgttgtccaacttgccggggcccactgggatccattcgcaacttggctatggagaag
gtggccaattcagtacttttcccttgtaaatatgcctcgtctggatgtgaaataactctg
ccacacacagagaaagcagaccacgaagagctgtgtgagtttaggccgtactcctgtccg
tgccctggtgcttcctgtaaatggcagggctctctggacgctgtaatgccccatctgatg
catcagcacaagtccattacaacccttcagggagaggatatagttttccttgctacagac
attaaccttcctggtgctgttgactgggtgatgatgcagtcctgtttcggctttcacttc
atgttagtcttggagaaacaggaaaaatatgatggtcaccagcagttctttgcaattgta
cagctgataggaacacgcaagcaagctgaaaattttgcttatcgacttgagctaaatggg
cacaggcgacgattgacttgggaggcgactcctcggtctattcatgagggaattgcgaca
gccatcatgaacagtgactgcctagtcttcgacaccagcatcgcacagctcttcgcagaa
aatggcaacttaggcatcaatgtaacgatttccatgtgttga

DBGET integrated database retrieval system