KEGG   Oryctolagus cuniculus (rabbit): 100355860Help
Entry
100355860         CDS       T03373                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04371  Apelin signaling pathway
ocu05034  Alcoholism
ocu05165  Human papillomavirus infection
ocu05169  Epstein-Barr virus infection
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100355860 (HDAC7)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    100355860 (HDAC7)
  09164 Substance dependence
   05034 Alcoholism
    100355860 (HDAC7)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    100355860 (HDAC7)
   05165 Human papillomavirus infection
    100355860 (HDAC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100355860 (HDAC7)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100355860 (HDAC7)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100355860 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100355860
NCBI-ProteinID: XP_017198741
LinkDB All DBs
Position
8
AA seq 1014 aa AA seqDB search
MPKKFQGENTKSAAARARRAEAKAAADAKRQQELEQQRQREQQRQEELEKQRLEQQLLIL
RNKEKSKESAIASTEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPP
QSGPPGTPPSYKLPLLGPYDNRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDG
TVISTFKKRAVEITGAGPGVPSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLP
QHRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSL
RQGGTLTGKFMSTSSIPGCLLGVALEGDASPHGHASLLQHVLLLEQARQQSALIAVPLHG
QSPLVTGERVATSMRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQ
QLQLGKMLTKTGELPRQPTTHPEETEEELTEQQEVLLGEGALPMPREGSTESESTQEDLE
EEEEDEEEDDEDCIQVKDEEGESGPEEGPDSEESSAGYKKLFPDAQQLQPLQVYQAPLSL
AAVPHQALGRTQSSPAAPGSVKSPPDQPTKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHA
GRIQSIWSRLQETGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLL
GPISQKMYAMLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLVELAFKVAAGELKNGFAIIR
PPGHHAEESTAMGFCFFNSVAITAKLLQQKLNVGKVLIVDWDVHHGNGTQQTFYQDPSVL
YISLHRHDGGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRTVVMPV
AREFSPDLVLVSAGFDAAEGHPAPLGGYRVSAKCFGCMTQQLMSLAGGAVVLALEGGHDL
TAICDASEACVAALLGNKVDPLAEEGWTQKPNLNAIRSLEAVIRVHSKYWGCMQRLAACP
GSWVPRGPGTDAEVEAVTALASLSVGILAEDSLASPPLHRPTEQLTEEEEPMNL
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagaagttccagggcgagaacaccaagtcggcggcggcccgggcgcgcagggcg
gaggccaaggcggcggcggacgccaagaggcagcaggagctggagcagcagcggcagcgg
gagcagcagcggcaggaggagctggagaagcagaggctggagcagcagctgctcatcctg
cgcaacaaggagaagagcaaagagagcgccatcgccagcacggaggtgaagctcaggctc
caggagttcctcctgtccaagtcaaaggagcccacgccaggcggcctcaaccattccctc
ccacagcaccccaaatgctggggagcccaccatgcttctttggaccagagttcccctccc
cagagcggcccccctgggacgcctccctcctacaaactgcctttgcttgggccctacgac
aaccgagatgacttcccgctccgcaagacagcctctgaacccaacttgaaagtgcgttcg
aggctaaaacagaaggtggcggagcggagaagcagtcccctcctgcgtcgcaaggacggg
accgtcatcagcacctttaagaagagagcagttgagatcacgggcgccgggcctggagtg
ccgtccgtgtgtaacagtgcgcctggttccggccccagctcccccaacagctcccacagc
accatcgccgagaacggcttcactggctcagttcccaacatccccaccgagatgctcccc
cagcaccgggccctccctctggacagctcccccaaccagttcagcctctacacgtctccc
tctctgcccaacatctccctagggctgcaggccacggtcactgtcaccaactcacacctc
actgcctccccgaagctgtcgacgcagcaggaggccgagaggcaggccctccagtccctg
cggcagggcggcacgctgacgggcaagttcatgagcacatcctccatcccgggctgcctg
ctgggcgtggcgctggagggcgacgccagcccccacggacacgcctccctgctacagcac
gtgctgctgctggaacaggcccggcagcagagcgccctcatcgcggtgccgctgcatggg
cagtccccgctggtgacaggggaacgcgtggccaccagcatgcggacggtgggcaagctc
ccgcggcaccggcccctgagccgcacccagtcctccccgctgccgcagagcccccaggcc
ctgcagcagctggtcatgcagcagcagcaccagcagttcctggagaagcagaagcagcag
cagctgcagctgggcaagatgctcaccaagaccggggagctgccgaggcagcccaccaca
caccctgaggagaccgaggaggagctgacggagcagcaggaggtcctgctgggggagggc
gccctgcccatgccccgggaaggctccacggagagtgagagcacccaggaagacctggag
gaggaggaggaggacgaggaagaggacgatgaggactgcatccaggtcaaggacgaggag
ggcgagagcggcccggaggaggggcccgactcggaggagtccagtgctggctacaaaaag
ctgttcccagatgcccagcagctgcagcccctgcaagtgtaccaggcgcccctcagcctg
gccgctgtgcctcaccaggccctgggccgcacccagtcctcacctgctgcccccgggagc
gtgaagagccccccagaccagcccaccaagcacctcttcaccacaggtgtggtttacgac
acgttcatgctgaagcaccagtgcatgtgtgggaacacgcacgtgcaccccgagcacgct
ggccgcatccagagcatctggtcccggctgcaggagacgggcctgctcagcaaatgtgag
cggattcggggtcgcaaagctacgctggacgagatccagacggtgcactctgagtaccac
accctgctctatgggaccagccccctcaaccggcagaagctggacagcaagaaactgctt
ggccccatcagccagaagatgtacgccatgctgccttgtgggggcatcggagtggacagt
gacaccgtgtggaacgagatgcactcgtccagtgctgtgcgcatggcagtgggctgcctc
gtggagctggccttcaaggtggccgcgggggagctcaagaatggatttgccatcatccgg
cccccaggacaccacgccgaggaatccacagccatgggattctgcttcttcaactctgta
gccatcacagccaaactcctgcagcagaagctgaacgtgggcaaggtcctcatcgtggac
tgggacgtgcaccacggcaatggcacgcagcagaccttctaccaggaccccagcgtgctc
tacatctctctgcaccgccacgacggcggcaacttcttcccgggcagcggggccgtggac
gaggtgggcgctggcagcggagagggcttcaacgtgaacgtggcctgggctggaggcctg
gacccccctatgggggaccccgagtacctggctgccttcaggacggtcgtgatgcccgtc
gcccgggagttctctccagacctggtgctggtgtcggcagggtttgatgcggccgagggc
caccctgcccccctgggtggctaccgagtctctgccaaatgtttcgggtgcatgacgcag
cagctgatgagcctggcaggaggcgccgtggtgctggccctggagggtggccatgacctc
acagccatctgtgacgcctcggaggcctgcgtggccgccctgctgggcaacaaggtggac
ccgcttgcagaagagggctggacgcagaagcccaacctcaacgccatccgctccctggag
gctgtgatccgtgtgcacagcaagtactggggctgcatgcagcgcctggccgcctgccct
ggctcctgggtgcccaggggcccggggaccgacgcagaagtggaggctgtgacagcactg
gcatccctctctgtgggcatcctggccgaagacagcctcgcctcccctcccctgcacagg
cctactgagcagctgacggaagaggaagaacccatgaacctctga

DBGET integrated database retrieval system