KEGG   Oryctolagus cuniculus (rabbit): 100356036
Entry
100356036         CDS       T03373                                 

Gene name
WDR33
Definition
(RefSeq) WD repeat domain 33
  KO
K15542  polyadenylation factor subunit 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100356036 (WDR33)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100356036 (WDR33)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100356036 (WDR33)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Collagen eIF2A Ge1_WD40
Other DBs
NCBI-GeneID: 100356036
NCBI-ProteinID: XP_002712246
Ensembl: ENSOCUG00000011375
UniProt: G1T170
LinkDB
Position
7
AA seq 1336 aa
MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYN
PSVIKYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKC
PVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETILQAHDSPVRAMTWSHNDMWMLTAD
HGGYVKYWQSNMNNVKMFQAHKEAIREASFSPTDNKFATCSDDGTVRIWDFLRCHEERIL
RGHGADVKCVDWHPTKGLVVSGSKDSQQPIKFWDPKTGQSLATLHAHKNTVMEVKLNLNG
NWLLTASRDHLCKLFDIRNLKEELQVFRGHKKEATAVAWHPVHEGLFASGGSDGSLLFWH
VGVEKEVGGMEMAHEGMIWSLAWHPLGHILCSGSNDHTSKFWTRNRPGDKMRDRYNLNLL
PGMSEDGVEYDDLEPNSLAVIPGMGIPEQLKLAMEQEQMGKDEANEIEMTIPGLDWGMEE
VMQKDQKKVPQKKVPYAKPIPAQFQQAWMQNKVPIPAPNEVLNDRKEDIKLEEKKKTQAE
IEQEMATLQYTNPQLLEQLKIERLAQKQAEQIQPPPSAGTPLLGPQPFPGQGPMSQIPQG
FQQPHPSQQMPMSMAQMGPPGPQGQFRPPGPQGQMGPQGPPLHQGGGGPQGFMGPQGPQG
PPQGLPRPQDMHGPQGMQRHPGPHGPLGPQGPPGPQGSSGPQGHMGPQGPPGPQGHMGPQ
GPPGPQGHLGPQGPPGTPGMQGPPGPRGMQGPPHPHGMQGGPGSQGIQGPVSQGPLMGLN
PRGMQGPPGPREGQGPAPQGMMMGHPPQELRGPHPPSGLLGHGPQEMRGPQEMRGMPGPP
PQGSMLGPPQELRGPPGSQGQQGPPQGSLGPPPQGGMQGPPGPQGQQNPARGPHPSQGPI
PFQQQKTPLLGDGPRAPFNQEGQSAGPPPLIPGLGQQGAQGRIPPLNPGQGPGPNKGDSR
GPPNHHMGSMAERRHEQSGGPEHGPERGPFRGGQDCRGPPDRRGPHPDFPDDFSRPDDFH
PDKRFGHRLREFEGRGGPLPQEEKWRRGGPGPPFPPDHREFSEGDGRSAARGPPGAWEGR
RPGDERFPRDPEDPRFRGRREESFRRGAPPPRHEGRAPPRGRDGFPGPEDFGPEESFDVA
EEAARGRDLRGRGRGTPRGGRKGLLPTPDEFPRFEGRKPDSWDGNREPGPGHEHFRDAPR
PDHPPHDGHSPASRERSSSLQGMDMASLPPRKRPWHDGPGTSEHRDMEAPGGPSEDRGGK
GRGGPGPSQRVPKSGRSSSLDGDHHDGYHRDEPFGGPPGSGTPSRGVRSSSTWGRGSNMN
SGPPRRGSSRGGGRGR
NT seq 4011 nt   +upstreamnt  +downstreamnt
atggccacagaaattggttctcctcctcgttttttccatatgccaaggttccagcaccaa
gcacctcgacaactgttttataagcgacctgattttgcacagcagcaagcaatgcaacaa
cttacctttgatggaaaacgaatgagaaaagctgtaaaccgaaaaaccatagactacaac
ccttctgtaattaagtatttggagaatagaatatggcaaagagaccagagagatatgcgg
gcaattcagcctgatgcaggctattataatgatctggtcccccctataggaatgttgaat
aatcctatgaatgctgtaaccacaaaatttgttcggacatcaacaaataaagtaaagtgt
ccagtatttgttgtaaggtggactccagaaggaagacgattggtcactggagcttccagt
ggagagttcaccttgtggaacggactcactttcaactttgaaacaatattacaggctcat
gatagcccagtgagggccatgacttggtcacataatgacatgtggatgctgacagcagac
cacggaggatatgtgaaatattggcagtcgaacatgaacaacgtcaagatgttccaggca
cataaggaggcgattagagaggccagtttctcacccacggataataaatttgctacatgc
tctgatgacggcactgttagaatctgggactttcttcgttgccatgaggaaagaattctc
cgagggcatggtgctgatgtgaaatgtgtagactggcatccaaccaaagggttagttgtt
tcaggaagtaaagatagtcaacagccaatcaagttctgggatcccaagactgggcagagt
cttgcaacacttcatgcccataaaaacaccgtaatggaagtgaagttaaatctcaatggg
aattggctgctcacagcatcacgtgaccatctctgtaagctttttgacatccgaaacctg
aaagaagagcttcaagtcttccggggtcataagaaagaagccacagctgtggcctggcat
cctgttcatgagggactttttgccagtggagggtctgacggttctttgttattctggcat
gttggggttgagaaggaagtgggtgggatggagatggcccacgaaggaatgatctggagt
ctggcttggcaccctcttggacatattctctgctcaggttcaaatgaccacaccagcaaa
ttctggactcgaaatcgaccaggtgataaaatgcgagatcgatataatctgaacctgtta
cctgggatgtctgaagatggagtagaatatgatgaccttgaacctaatagcctggccgta
attccagggatgggaataccagaacaactaaaattagctatggaacaagaacagatgggg
aaagatgaagcaaatgaaatcgaaatgacaattcctggtttagattggggaatggaggaa
gtgatgcaaaaggatcagaaaaaagtacctcagaagaaagttccttatgcaaaacctatt
cctgctcagttccagcaggcttggatgcaaaataaagttccaattcctgctccaaatgag
gtgctgaatgacagaaaagaggacattaaattggaagagaagaaaaaaacacaagcagaa
attgagcaagaaatggccacattacagtataccaacccacaacttctggagcaactcaaa
attgaaagactggcacagaagcaggctgagcaaatccagcctcctccctcagctggcact
cctctcctcggaccccagcccttccctggacaaggtccaatgtcgcagattcctcaaggt
tttcaacaacctcacccatctcagcagatgccaatgagcatggctcagatgggacctcca
ggtccacaaggacagtttagaccccctggaccccaggggcaaatgggaccacaaggccct
ccactgcatcagggaggtggggggccacaaggattcatgggaccacaagggccccagggc
ccgcctcaggggctgccacggcctcaggacatgcacgggccccaaggaatgcagaggcat
cctggacctcatggccctttggggcctcaaggaccacctggaccacagggtagttctggt
cctcaaggtcatatgggtccccagggtccacctggcccccagggtcacatgggcccccaa
ggtccacctggtccccagggtcacttgggcccccaggggcctcctggtacgccaggtatg
cagggaccacctggtcccagaggaatgcaaggacctcctcatcctcatggaatgcaaggc
gggcctgggtctcaagggatccaaggccctgtgtctcagggacctctgatgggattgaat
ccaagaggaatgcaaggccctcctggcccccgggagggtcagggtcctgctccccaaggc
atgatgatgggtcacccgcctcaagaactgagaggacctcaccctccgagcggactcctt
ggccatggccctcaggaaatgagaggtcctcaggagatgcggggcatgcccgggccgcca
ccccaaggatcgatgctgggccctccccaggaactgcgcgggccaccaggctcacaaggc
cagcaggggccgccccagggctctttgggacctccaccccagggtggcatgcaagggccc
cctggacctcagggacagcagaacccagcaagagggccacatccgtctcaagggccaata
ccattccagcaacagaaaacacctctgctaggcgatgggccccgggcgcccttcaatcag
gaaggacagagcgcaggccccccacccctgatcccaggcctagggcagcagggagcacaa
ggccgcatcccccctctgaaccccggacaaggacctggccctaacaaaggtgactcccgc
ggccccccaaaccatcacatgggctcgatggcagagaggcggcatgagcagagcggcggc
cctgagcacgggcctgagagggggcctttccggggcggccaggactgcaggggtccccct
gataggcgcggccctcaccccgacttccccgatgacttcagcagaccagacgactttcac
cccgacaagcgctttggccaccgattacgtgaatttgagggtcgaggaggacctttacca
caagaagagaagtggaggcgaggggggcccgggcctccgtttcctcctgatcacagggaa
ttcagtgagggcgatggccgcagtgcagcccgaggccccccgggggcatgggaaggccgc
agacctggagatgaacgattcccccgggatcccgaggacccacgttttcgagggcgcaga
gaagaaagcttccgaagaggggcccccccgccgaggcatgagggccgtgccccccccaga
gggagggacggtttccctggtcctgaagactttgggccggaggagagttttgatgtggct
gaggaagcggcccgaggccgggatctcagaggtcgaggtcggggaaccccacgaggagga
aggaagggtttgctccccactccggacgagttcccacgctttgaaggacgaaagccagac
tcctgggatggaaaccgagagccagggcctggtcatgagcatttccgtgacgctccccgc
cctgatcatccccctcatgatggtcattccccagccagcagagaacgctcctcttctctc
caaggcatggacatggcgtccctcccgccccgaaagcgcccttggcacgatgggccaggc
acgtccgagcaccgagacatggaagccccaggaggcccttctgaagaccgaggaggcaaa
ggccgagggggcccaggaccttcccagagagtgccaaaatccggccgttccagctctttg
gacggagaccaccatgatggataccacagagacgaacctttcgggggccccccgggcagt
ggcacgccttctcgaggggtccggagtagcagtacctggggtagaggaagtaacatgaac
tctggcccaccgaggcggggctcttcccggggcggtggaaggggtcggtag

DBGET integrated database retrieval system