KEGG   Oryctolagus cuniculus (rabbit): 100356081
Entry
100356081         CDS       T03373                                 

Gene name
IL33
Definition
(RefSeq) interleukin 33
  KO
K12967  interleukin 33
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04217  Necroptosis
ocu04623  Cytosolic DNA-sensing pathway
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100356081 (IL33)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100356081 (IL33)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    100356081 (IL33)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100356081 (IL33)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100356081 (IL33)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100356081 (IL33)
SSDB
Motif
Pfam: IL33 EstA_Ig_like
Other DBs
NCBI-GeneID: 100356081
NCBI-ProteinID: XP_008253211
LinkDB
Position
1
AA seq 208 aa
MKLRSGLTIEKKACYFRRGITKKPDGKFQVEALRGPSFTEAGRTEEYLERTGTQAALSSF
LEYPASLSTYNDKSVTFTLVDKSYVINVGDKGKKQKKDKVLLRYYESPYSSSESGDGVDG
KMLMVNMSPTNDAHLLLHANKKKHSVEFHRYENRLSDLAFFVVHKESSECVSFECKSHRG
TYLGVKDNHLGLIQGKNPGSENILFKLS
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctacgctctggccttaccatagaaaagaaggcctgttactttaggagaggaatc
accaaaaagccagatggaaaattccaagtcgaagctttgcggggaccgtccttcactgaa
gcaggcaggactgaagaatacttggaacgtacgggaacacaggctgctctaagtagtttc
ctagaatatcctgcctctctgagcacatacaacgataaatcagttacttttactttggtg
gataaaagttatgtgatcaatgttggagacaaggggaagaaacaaaagaaagacaaggtg
ttactgcgttactatgagtccccgtactcctcaagtgaatcaggtgatggcgttgatggt
aagatgttaatggtaaacatgagtccaacaaatgacgcacatctcttgctgcatgccaac
aagaagaagcactccgtagagtttcacaggtatgaaaacagattatcagacctagctttc
tttgtcgttcacaaggagtcttcggaatgtgtttcattcgaatgtaaaagccatcgcgga
acatatttaggagtaaaagataatcaccttggcctaatacaaggaaagaatccaggcagt
gagaatattctgtttaagctctcttag

DBGET integrated database retrieval system