KEGG   Oryctolagus cuniculus (rabbit): 100356164
Entry
100356164         CDS       T03373                                 

Gene name
MTOR
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu04012  ErbB signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04136  Autophagy - other
ocu04140  Autophagy - animal
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04218  Cellular senescence
ocu04371  Apelin signaling pathway
ocu04613  Neutrophil extracellular trap formation
ocu04630  JAK-STAT signaling pathway
ocu04659  Th17 cell differentiation
ocu04714  Thermogenesis
ocu04910  Insulin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04930  Type II diabetes mellitus
ocu04931  Insulin resistance
ocu04935  Growth hormone synthesis, secretion and action
ocu05010  Alzheimer disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05221  Acute myeloid leukemia
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100356164 (MTOR)
   04371 Apelin signaling pathway
    100356164 (MTOR)
   04630 JAK-STAT signaling pathway
    100356164 (MTOR)
   04066 HIF-1 signaling pathway
    100356164 (MTOR)
   04072 Phospholipase D signaling pathway
    100356164 (MTOR)
   04151 PI3K-Akt signaling pathway
    100356164 (MTOR)
   04152 AMPK signaling pathway
    100356164 (MTOR)
   04150 mTOR signaling pathway
    100356164 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100356164 (MTOR)
   04136 Autophagy - other
    100356164 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    100356164 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100356164 (MTOR)
   04659 Th17 cell differentiation
    100356164 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100356164 (MTOR)
   04920 Adipocytokine signaling pathway
    100356164 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    100356164 (MTOR)
   04919 Thyroid hormone signaling pathway
    100356164 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    100356164 (MTOR)
   04213 Longevity regulating pathway - multiple species
    100356164 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    100356164 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100356164 (MTOR)
   05206 MicroRNAs in cancer
    100356164 (MTOR)
   05205 Proteoglycans in cancer
    100356164 (MTOR)
   05230 Central carbon metabolism in cancer
    100356164 (MTOR)
   05231 Choline metabolism in cancer
    100356164 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100356164 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100356164 (MTOR)
   05212 Pancreatic cancer
    100356164 (MTOR)
   05225 Hepatocellular carcinoma
    100356164 (MTOR)
   05226 Gastric cancer
    100356164 (MTOR)
   05214 Glioma
    100356164 (MTOR)
   05221 Acute myeloid leukemia
    100356164 (MTOR)
   05215 Prostate cancer
    100356164 (MTOR)
   05224 Breast cancer
    100356164 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100356164 (MTOR)
   05014 Amyotrophic lateral sclerosis
    100356164 (MTOR)
   05016 Huntington disease
    100356164 (MTOR)
   05017 Spinocerebellar ataxia
    100356164 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    100356164 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100356164 (MTOR)
   04931 Insulin resistance
    100356164 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100356164 (MTOR)
   05168 Herpes simplex virus 1 infection
    100356164 (MTOR)
   05163 Human cytomegalovirus infection
    100356164 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100356164 (MTOR)
   05165 Human papillomavirus infection
    100356164 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100356164 (MTOR)
   01522 Endocrine resistance
    100356164 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100356164 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100356164 (MTOR)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100356164 (MTOR)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100356164 (MTOR)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100356164 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 Adaptin_N V-ATPase_H_N UME EPSP_synthase Nipped-B_C HEAT_EZ
Other DBs
NCBI-GeneID: 100356164
NCBI-ProteinID: XP_002723399
Ensembl: ENSOCUG00000013053
UniProt: G1T4N5
LinkDB
Position
Un
AA seq 2547 aa
MLGTGPAAAAAAAATSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDASERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAVQVDA
TVFTCVSMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLNTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTPIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSQGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLASRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPDLRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLA
RHRISHQRYDVLICRILKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVNPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSSRKIDAFQHMQHFVQSMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYCSAATEHDRGWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHGSGANITTAATATAATATTTASTEGSNSESEAESAENSPTP
SPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEA
LVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKS
TTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGER
NVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWD
LYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQV
ITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSI
QRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQ
KVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPS
NLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHT
VMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVE
LGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLDVP
TQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7644 nt   +upstreamnt  +downstreamnt
atgctggggaccgggcccgccgctgccgccgccgccgccgccacctcaagcaacgtgagc
gtcctgcagcagtttgccagtggcctgaagagccggaatgaggagaccagggccaaggct
gccaaggagctccagcactacgtcaccatggagctccgcgagatgagtcaggaagagtca
acgcggttctacgatcagctgaaccatcacatatttgaactggtttccagctccgatgcc
agtgagaggaaagggggcatcttggccatagccagcctcatcggcgtggaaggtgggaat
gccacccggatcggcaggtttgccaactatcttcggaatctcctcccctccaatgaccca
gttgtcatggagatggcatccaaggccattggccgccttgccatggcaggggacactttc
actgccgagtacgtggagttcgaggtgaagcgagccctggaatggctgggtgctgaccgc
aacgagggccggagacacgccgctgtcctggttctccgtgagctggccatcagcgtcccc
accttcttcttccagcaagtgcagcccttcttcgacaacatttttgtggccgtgtgggac
cccaaacaggccatccgtgagggagccgtggccgccctccgtgcctgtctcatcctcacc
actcagcgagagccgaaggagatgcagaagccgcagtggtaccggcacacgttcgaagag
gcagagaaggggtttgatgagaccctggccaaggagaaggggatgaatcgggatgaccgg
atccacggagccttgctgatcctcaacgagctggttcggatcagcagcatggagggcgag
cggctgagagaagagatggaagaaatcacccagcagcagctggtgcacgacaagtactgc
aaagatctcatgggcttcggaacaaaacctcggcacatcacgcccttcaccagtttccag
gctgtgcagccccagcagtcgaacgccttggtggggctgctgggctacagctctcaccaa
ggcctcatgggattcggggcctcccccagcccagctaagtccaccctggtcgagagccgg
tgttgccgagacttgatggaggaaaaattcgatcaggtgtgccagtgggtgctgaagtgc
aggaacagcaagaactcgctgatccaaatgacgatccttaatctgttgccccgcctggct
gcattcagaccttctgcctttacagacactcagtacctccaggacaccatgaaccacgtc
ctaagctgtgtcaagaaggagaaggaacggacagcagctttccaagctctggggctgctt
tctgtggctgtgaggtcagagttcaaggtctacttgcctcgtgtgctggacatcatccgg
gcggccctgccccctaaggactttgcccacaagaggcagaaggcagtacaggtggacgcc
acggtgttcacgtgtgtcagcatgctggcacgcgcaatggggccaggcatccagcaggac
atcaaggagctgctggagcccatgctggctgtgggactgagcccggcgctcactgctgtg
ctctacgacctgagccgccagatcccgcagctgaagaaggacatccaggacgggctcctg
aagatgctgtccctggtccttatgcacaaacctctccgacacccaggcatgcccaagggc
ctggcccaccagctggcctcccccgggctcaacaccctgcccgaggccagcgatgtgggc
agcatcactctcgccctccggacccttggtagcttcgaatttgaaggccactctctgacc
cagtttgttcgccactgtgcggatcatttcctgaacagtgagcacaaggagatccgcatg
gaagctgcccgcacctgctcgcgtctgctcaccccctccatccacctcatcagcggccac
gcacacgtggttagccagacggcagtgcaggtggtggcagacgtgctcagcaagctgctc
gtggtcgggataacagatcctgaccctgacatccgctactgtgtcttggcatccctggat
gagcgcttcgacgcacacctggcccaggcagagaatttgcaggcgctgtttgtggccctg
aatgaccaggtgttcgagatccgggagctggccatctgcactgtgggccggctcagcagc
atgaacccggcctttgtcatgcctttcctgcgcaagatgctcatccagatcctgacagag
ctggagcacagcggcattgggagaatcaaggagcagagtgcccgcatgctgggacacctg
gtttcgaacgccccccgactcatccgcccctacatggagcctattctgaaggctttaatt
ttgaaattgaaagacccagatcctgatccaaacccaggtgtgatcaataatgtcttggcc
acaataggagaactggctcaagttagtggcctggaaatgaggaagtgggttgacgagctt
ttcatcatcatcatggacatgctccaggactcctccctgttggccaagaggcaggtggct
ctgtggaccctgggacagttggtggccagcactggctatgtcgtggagccctataggaag
taccccactttgcttgaggtgctgctgaatttcctgaagactgagcagaatcagggtaca
cggagagaggccatccgtgtgttggggctgttgggggctctggacccctacaagcacaag
gtgaacatcggcatgattgaccagtcccgggacgcatctgctgtcagcctgtcagagtcc
aagtccagccaggattcctctgactacagcaccagtgaaatgctggtcaacatgggaaac
ctgcctctggacgagttctaccctgctgtgtccatggtggccctgatgcggatcttccga
gaccagtctctgtctcatcatcacaccatggttgtccaggccatcaccttcatcttcaag
tccctggggctcaagtgtgtgcagttcctgccccaggtcatgcccacattcctgaatgtc
attcgagtctgtgacggggccatccgggaatttctgttccagcagctgggaatgctggtg
tcctttgtgaagagccacatcagaccgtacatggatgaaatcgtcaccctcatgagagaa
ttctgggtcatgaacaccccgatccagagcaccatcattctgcttattgagcaaattgtg
gttgctcttgggggtgaattcaagctctacctgccccagctcatcccgcacatgctgcgt
gtcttcatgcatgacaacagccaaggccgcatcgtctccatcaagctgttggctgcgatc
cagttgttcggggccaatctagacgattacctgcatctgctgctgcctcctatagtgaag
ctgtttgatgctccggaagtcccactggcctctcggaaggcagccttggagacggtggac
cgcctgacagagtccctggacttcaccgactatgcctcccgcatcatccacccgattgtc
cgaacgctggaccagagccccgatctgcgttccacagccatggacacgttgtcctcactt
gtcttccagctggggaagaagtaccagattttcattccaatggtgaataaggtcctggcg
cggcaccggatcagccatcagcgctacgatgtgctcatctgcagaatcctcaagggatac
acccttgctgatgaagaggaggaccccttgatttatcaacatcgaatgttgaggagtggc
caaggggatgcattggccagtggaccagtagaaacaggacccatgaagaagctgcatgtc
agcaccatcaacctgcaaaaggcctggggagccgccaggagggtctccaaagacgactgg
ctggagtggctgcggcggctgagcctggagctgctgaaggactcctcgtccccctccctg
cgctcgtgctgggccctggcgcaggcctacaacccgatggccagggacctcttcaatgct
gcttttgtgtcctgctggtcagaactgaatgaagaccagcaggacgaactcatcagaagc
atcgagctggcccttacctcacaggacatcgctgaagtcacacagacactcttgaacttg
gctgagttcatggagcatagtgataagggccccctgccactgagagatgacaatgggatt
gttctgctgggcgagagagctgccaagtgccgagcgtatgccaaagccctgcactacaag
gagctggagttccagaagggccccacccccgccattttggagtctctcatcagcatcaat
aataagcttcagcagccggaggcagctgccggggtgctggagtatgccatgaaacacttc
ggagagctggagatccaggccacgtggtatgagaagctgcacgagtgggaggacgccctc
gtggcctatgacaagaaaatggacaccaacaaggatgaccctgagctgatgctgggccgc
atgcgctgtctggaggccctgggggaatggggacagctccaccagcagtgctgtgaaaag
tggaccttggtgaatgatgaaacccaagccaagatggcccggatggctgctgcagctgcg
tggggcctaggccagtgggacagcatggaagagtacacctgcatgatccctcgggacacg
cacgatggggcgttctacagagctgtgctggcgctgcatcaggacctcttctcgttggcc
caacagtgtatcgacaaggccagggacctgctggatgcagagctcaccgccatggcagga
gagagctacagccgggcatacggggccatggtttcttgccacatgctctctgagctggag
gaggttatccagtacaaacttgttcctgagcggcgcgagatcatccgtcagatctggtgg
gagcgactgcagggctgccagcgtattgtagaggactggcagaaaatcctcatggtgcga
tcccttgtggtcaaccctcatgaggacatgagaacatggctcaagtacgcaagcctgtgt
ggcaagagcggccggctggcgcttgcccataaaaccttagtgttgcttctgggagtcgat
ccatctcgccaacttgaccaccctctgccaacagttcaccctcaggtgacctacgcctac
atgaagaacatgtggaagagctctcgtaagatcgatgccttccagcacatgcagcacttt
gtgcagagcatgcagcagcaggcccagcacgccatcgccaccgaggaccagcagcacaag
caggagctgcacaagctgatggcccgctgtttcctgaagcttggggagtggcagctgaac
ctgcagggcatcaacgagagcaccatccccaaggtgctgcagtactgcagcgccgccacc
gagcacgaccgcggctggtacaaggcctggcacgcgtgggcagtgatgaactttgaagct
gtgctgcactacaagcatcagaaccaagcccgtgacgagaagaagaagctgcgccacggc
agcggggccaacatcaccaccgccgccaccgccaccgccgccaccgccaccactaccgcc
agcaccgagggcagcaacagcgagagcgaggccgagagcgccgagaacagccccaccccc
tcccccctgcagaagaaggtcactgaggatttgtccaaaaccctcttgatgtatactgtc
cctgcggtccagggcttcttccgttccatctccttgtcacgaggcaacaacctgcaggac
acgctcagagtcctcaccctgtggtttgattatggccactggccagatgtcaatgaagcc
ctagtggaaggggtgaaagcgatccagattgacacctggttgcaggtgatacctcagctc
attgcaaggattgatacacccagacccctggtgggacggctcatccaccagcttctcaca
gacatcggtcggtaccacccccaggccctcatctacccgctgaccgtggcgtctaagtcc
accacgacggcccgtcacaatgcggccaacaagatcctcaagaacatgtgtgagcacagc
aacaccctggtccagcaagccatgatggtgagtgaggagctgatccgcgtggccatcctc
tggcatgagatgtggcacgagggcctggaagaggcttctcgtttgtactttggggagagg
aacgtgaagggcatgttcgaggtgctggagcccctgcacgccatgatggagcggggcccc
cagaccctgaaggagacgtccttcaatcaggcgtatggccgagacctgatggaggcccag
gagtggtgccgcaagtacatgaagtcggggaacgtcaaggacctcacccaggcctgggac
ctctactaccacgtgttcaggcggatctcgaagcagctgccccagctcacatccttagag
ctacagtatgtctccccaaaacttctgatgtgccgggaccttgaattggctgtgccagga
acgtatgaccccaaccagccaatcattcgcattcagtccatagccccgtctttgcaagtc
atcacgtctaagcagaggccccgaaagctgacactcatgggcagcaacgggcatgagttt
gttttcctcctcaaggggcacgaagacctgcggcaggacgagcgggtgatgcagctcttc
ggcctggttaacaccctcctggccaacgacccgacgtctcttcggaagaatctcagcatc
cagagatacgccgtcattcctctgtcgaccaactcgggcctcattggctgggtcccgcac
tgtgacacgctgcacgccctcatccgggactacagggagaaaaagaagatccttctcaac
attgagcatcgcatcatgttgcggatggctccagactacgaccacttgactctgatgcag
aaggtggaggtgtttgagcacgccgtcaataacacagccggagacgacctggccaagctg
ctgtggctgaagagccccagctcagaggtgtggtttgaccgaagaaccaattacacccgc
tcgttagccgtcatgtcaatggtggggtatattttgggcctgggagatagacacccgtcc
aatctgatgctagaccggctgagtgggaagatcctgcacattgactttggagactgcttt
gaggttgctatgaccagagagaagttcccagagaagattccatttagactaacgagaatg
ttgaccaatgctatggaggtgactggtctggatggcaactacagaatcacctgccacacc
gtgatggaggtgctgcgggaacacaaggacagtgtcatggccgtgctggaggccttcgtc
tacgaccccttgctgaactggaggctgatggacacaaataccaaaggcaacaagcgatcc
cggacgcgaacagattcctactctgcgggccagtcagtagaaattttggacggtgtagaa
cttggagaaccagcccataagaaaacggggaccacagtgccagaatccattcattctttc
attggagacgggttggtgaaaccagaagccctaaataagaaagccattcagatcattaac
agggtccgcgataagctcaccggtcgggacttctcgcacgatgacactctggacgtccca
acacaagtggaactgctcatcaagcaagccacgtcccatgagaacctctgccagtgctac
atcggctggtgtcctttctggtaa

DBGET integrated database retrieval system