KEGG   Oryctolagus cuniculus (rabbit): 100356299
Entry
100356299         CDS       T03373                                 

Gene name
FHIT
Definition
(RefSeq) fragile histidine triad
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00230  Purine metabolism
ocu01100  Metabolic pathways
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100356299 (FHIT)
 09160 Human Diseases
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100356299 (FHIT)
   05223 Non-small cell lung cancer
    100356299 (FHIT)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     100356299 (FHIT)
SSDB
Motif
Pfam: HIT DcpS_C
Other DBs
NCBI-GeneID: 100356299
NCBI-ProteinID: XP_002713457
UniProt: A0A5F9D2D4
LinkDB
Position
9
AA seq 149 aa
MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLRPDEVADLFQ
ATQRVGTVVEKHFQGTSLTFSIQDGPEAGQTVKHVHVHILPRKAGDFCRNDSIYDELQKH
DKEEEDSQASWRSEEEMAAEAAALRAYFQ
NT seq 450 nt   +upstreamnt  +downstreamnt
atgtcattccgattcggtcagcatctcatcaagccctccgtggtgtttctcaaaacagaa
ttgtcctttgctcttgtgaacagaaaacctgtggtaccaggacatgtccttgtgtgccca
ctgcggccagtggagcgcttccgggacctgcgacctgatgaagtggctgatttgttccag
gcaactcagagagttgggacagtggtggaaaagcatttccaagggacctcgctcaccttt
tccattcaggatggtcctgaagctggacagactgtgaagcacgtccatgtccacattctt
cccaggaaggctggagacttttgcaggaatgacagcatctatgatgagctccagaaacat
gacaaagaagaggaggactctcaggcctcttggagatcagaggaagaaatggcagccgaa
gcagcggcgctgcgtgcctactttcagtga

DBGET integrated database retrieval system