KEGG   Oryctolagus cuniculus (rabbit): 100356364
Entry
100356364         CDS       T03373                                 

Gene name
SAP18
Definition
(RefSeq) Sin3A associated protein 18
  KO
K14324  histone deacetylase complex subunit SAP18
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100356364 (SAP18)
   03015 mRNA surveillance pathway
    100356364 (SAP18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100356364 (SAP18)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100356364 (SAP18)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     100356364 (SAP18)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     100356364 (SAP18)
SSDB
Motif
Pfam: SAP18
Other DBs
NCBI-GeneID: 100356364
NCBI-ProteinID: XP_002712847
Ensembl: ENSOCUG00000012716
LinkDB
Position
8
AA seq 172 aa
MLAAGVGGQSERLAGRRRKMAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHH
RMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDIKRPGY
RVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPTSGRMRPY
NT seq 519 nt   +upstreamnt  +downstreamnt
atgctcgctgcaggggtcggaggtcagagcgagcgtctcgcgggccgtaggaggaagatg
gcggtggaatcgcgcgttacccaggaggaaattaaaaaggagccagagaagccgattgac
cgcgagaagacatgcccgctgctgctgcgggtcttcaccaccaataacggccgccaccac
cgaatggatgagttctcccgcggaaacgtaccgtccagcgagctgcagatctacacttgg
atggatgcaaccctgaaagaattgaccagtttagttaaagaagtctacccagaagctaga
aagaagggcacacatttcaattttgcaattgtttttacggatattaaaagacctggttat
cgagttaaggagattggcagcaccatgtccggcagaaaggggactgatgactccatgacc
ctgcagtcacagaagttccaaataggagattatttggacatagcgatcacccctccgaat
cgggcaccacccacttcagggcgcatgagaccatattaa

DBGET integrated database retrieval system