KEGG   Oryctolagus cuniculus (rabbit): 100356540
Entry
100356540         CDS       T03373                                 

Gene name
MAVS
Definition
(RefSeq) mitochondrial antiviral signaling protein
  KO
K12648  mitochondrial antiviral-signaling protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100356540 (MAVS)
   04622 RIG-I-like receptor signaling pathway
    100356540 (MAVS)
   04623 Cytosolic DNA-sensing pathway
    100356540 (MAVS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100356540 (MAVS)
   05164 Influenza A
    100356540 (MAVS)
   05161 Hepatitis B
    100356540 (MAVS)
   05160 Hepatitis C
    100356540 (MAVS)
   05168 Herpes simplex virus 1 infection
    100356540 (MAVS)
   05169 Epstein-Barr virus infection
    100356540 (MAVS)
SSDB
Motif
Pfam: CARD_2
Other DBs
NCBI-GeneID: 100356540
NCBI-ProteinID: XP_002710934
Ensembl: ENSOCUG00000012269
UniProt: U3KPC4
LinkDB
Position
4
AA seq 541 aa
MTFAEDKTYKYICHHHSSFCRVDVLEILPYLPCLTANDQDRLRASYTRLGNRDTLWDLFN
SLQRRTGWVDSFIRGLRACELPELADQVAGEYQRHLPRAASHPGAPRGAPQEAPSLPAEV
PGASAPAANPSIPHAGHREEPSYPLPVQDTQPPKSLGEGSEQTPHTPSSGVLLRTPSVPL
EPSSSDPAALGPPSPSRPQEQDTDLASIHTAGSGSSPAPPCGPVSPSVSFQPLARSTPRA
SRLPGPATSVSSAGTSSPPGLAAGQGAGVQAKATVCSSDTVPTSSVPPSAASSRVPSNAM
SGDTVAPTAPASSAFTSTVPSKLPTSAKPPSATSSNVLPSVAPSKLPISSTGAGTVSPKV
PASTAPTKTPASTAPTKTPAGMAPTVKSSTRAAGTPVAPAPRGATGGSEPWPDGSSGSLH
SGPEVSKPGVLASRLDSQPFSGCSADLAISPSNSLLPEPGHGPEENEYVSVGTFGLHVVE
CPSADLESKPGLSATQQPPQPTDETVQWVWAEPWALWFGAAVASALMATLLAVLYRRRLL
H
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgacgtttgctgaggacaagacctacaagtacatctgccaccaccacagcagcttctgc
cgtgtggatgttctggagatcctgccttacctgccctgccttacggcaaatgaccaggat
cggctgcgggcctcctacacgcgcctgggcaaccgagacaccctctgggacctgttcaac
agcctgcagcggcggaccggctgggtggattccttcatccggggcctgagggcctgcgag
ctgccggagctcgctgaccaagtggctggcgaatatcagcgccacctgcctcgggctgca
tcccacccgggagcccctcgcggggcaccacaggaggcgccatcacttcctgccgaggtt
cctggggcctctgcacctgctgcaaaccccagcatcccccacgctggccacagagaggag
ccaagttaccccttgcctgtccaggacacccagcctcccaagtccctgggagagggttca
gagcaaacgccacacacacccagctctggggtcctcctgaggacacccagcgttcccctg
gagccctcctcctctgacccagcagccctcggccctccgagccccagcaggcctcaggag
caggacacagacttggccagcatccacacagcaggctccggctccagccccgcgccaccc
tgcggacctgtgtctccgtccgtctccttccagcctctggcccgttccactcccagggcg
agccgcttgcccggacccgccacgtcagtttcatccgctggcacctcctcaccccctggc
ttggctgctggacagggtgctggtgtccaggcaaaggccaccgtatgctccagcgacaca
gtgcccaccagctctgtgccccccagtgcagcatcctccagggtgcccagcaacgcaatg
tctggggacacagtagcccccacagcgcctgccagctccgcattcaccagcacggtgccc
tccaagttgcccaccagcgcaaagccccccagcgcaacgtcctccaacgtgcttcccagt
gtagcaccatccaaactgcccatcagctcaacaggtgctggcacggtgtcacccaaagtg
cctgccagcacggcgcccaccaaaacacctgccagcacggcgcccaccaaaacacctgcc
ggcatggcgcccaccgtcaagagcagcaccagggctgcggggaccccggtggctccagca
cccagaggtgccacaggaggcagtgagccctggccagacggcagctctggcagcttgcac
tctgggccggaggtgagcaagccaggtgtgctggcctcccggctggacagccagcctttc
tcgggctgctccgcggatctcgccatcagccccagcaactcgctgctccccgagcccggc
cacggcccagaggagaacgagtacgtgtcggtgggcacttttgggctccacgtggtagaa
tgtcccagcgctgacctggaaagcaaacctgggctgagcgccacccaacagcctccacag
cccacggacgagactgtgcaatgggtctgggcagagccctgggctttgtggtttggggca
gccgtggccagcgcactcatggccacactgctggctgtgctgtaccggcggcgcctgctt
cactga

DBGET integrated database retrieval system