KEGG   Oryctolagus cuniculus (rabbit): 100357341
Entry
100357341         CDS       T03373                                 

Gene name
NFKBIA
Definition
(RefSeq) NFKB inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04210  Apoptosis
ocu04380  Osteoclast differentiation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04668  TNF signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04926  Relaxin signaling pathway
ocu04931  Insulin resistance
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05215  Prostate cancer
ocu05220  Chronic myeloid leukemia
ocu05222  Small cell lung cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100357341 (NFKBIA)
   04668 TNF signaling pathway
    100357341 (NFKBIA)
   04024 cAMP signaling pathway
    100357341 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100357341 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100357341 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    100357341 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    100357341 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    100357341 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    100357341 (NFKBIA)
   04660 T cell receptor signaling pathway
    100357341 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    100357341 (NFKBIA)
   04659 Th17 cell differentiation
    100357341 (NFKBIA)
   04657 IL-17 signaling pathway
    100357341 (NFKBIA)
   04662 B cell receptor signaling pathway
    100357341 (NFKBIA)
   04062 Chemokine signaling pathway
    100357341 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100357341 (NFKBIA)
   04926 Relaxin signaling pathway
    100357341 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100357341 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100357341 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100357341 (NFKBIA)
   05203 Viral carcinogenesis
    100357341 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100357341 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100357341 (NFKBIA)
   05215 Prostate cancer
    100357341 (NFKBIA)
   05222 Small cell lung cancer
    100357341 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100357341 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100357341 (NFKBIA)
   05135 Yersinia infection
    100357341 (NFKBIA)
   05134 Legionellosis
    100357341 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100357341 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    100357341 (NFKBIA)
   05162 Measles
    100357341 (NFKBIA)
   05164 Influenza A
    100357341 (NFKBIA)
   05161 Hepatitis B
    100357341 (NFKBIA)
   05160 Hepatitis C
    100357341 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    100357341 (NFKBIA)
   05163 Human cytomegalovirus infection
    100357341 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100357341 (NFKBIA)
   05169 Epstein-Barr virus infection
    100357341 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100357341 (NFKBIA)
   05140 Leishmaniasis
    100357341 (NFKBIA)
   05142 Chagas disease
    100357341 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100357341 (NFKBIA)
   04131 Membrane trafficking [BR:ocu04131]
    100357341 (NFKBIA)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    100357341 (NFKBIA)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100357341 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 100357341
NCBI-ProteinID: XP_002718188
Ensembl: ENSOCUG00000015642
UniProt: G1T9W2
LinkDB
Position
17
AA seq 314 aa
MFQPAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP
RAAEPWRQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TSQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLKQTCTAQHLHSILQAIN
YNGHTCLHLASIHGYLGIVELLVSWGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQRLPESEDEESCDTESDGTEDEL
PYDDCVFGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtttcagccggccgagcacgctcaggactgggccatggaggggccccgggacgcgctg
aagaaggagcgcctgctggacgaccgccacgacagcggcctggactccatgaaggacgag
gagtacgagcagatggtgaaggagctgcgcgagatccgcctggagccgcaggaggcgccg
cgcgccgccgagccctggaggcagcagctcacggaggacggagactcgttcctccacttg
gccatcatccatgaagagaaggcattgaccatggaagtgattcgccaggtgaagggagac
ctggccttcctcaacttccagaacaacctgcagcagacgccgctccacttggctgtcatc
actagccagccagaaattgctgaggcactgctggaagctggctgtgatcctgagctgcgg
gactttcgaggaaacactccgctgcaccttgcctgcgagcagggctgcctggccagcgtg
ggcgtcctcaagcagacctgcacggcccagcacctgcactccattctgcaggccatcaac
tacaacggccacacgtgtctgcacctggcttccatccacggctacctgggcatcgtggag
ctgttggtgtcctggggtgctgatgtcaacgcccaggaaccctgcaatgggcgcacggcc
ctccacctcgccgtggacctgcagaatccggacctggtgtcgctcttgttgaagtgcggg
gccgatgtcaaccgggtcacctaccagggctactccccgtaccagctcacatggggccgc
cccagcacccggatccagcagcagctgggccagctgaccttggagaacctccagaggttg
cccgagagtgaggacgaggagagctgtgacacggagtcggacggcacggaggatgagctg
ccctatgatgactgcgtgttcggaggccagcgcctgaccttgtga

KEGG   Oryctolagus cuniculus (rabbit): 100359283
Entry
100359283         CDS       T03373                                 

Gene name
NFKBIB
Definition
(RefSeq) NFKB inhibitor beta
  KO
K02581  NF-kappa-B inhibitor beta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04062  Chemokine signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu05140  Leishmaniasis
ocu05145  Toxoplasmosis
ocu05162  Measles
ocu05164  Influenza A
ocu05169  Epstein-Barr virus infection
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100359283 (NFKBIB)
   04622 RIG-I-like receptor signaling pathway
    100359283 (NFKBIB)
   04623 Cytosolic DNA-sensing pathway
    100359283 (NFKBIB)
   04660 T cell receptor signaling pathway
    100359283 (NFKBIB)
   04658 Th1 and Th2 cell differentiation
    100359283 (NFKBIB)
   04659 Th17 cell differentiation
    100359283 (NFKBIB)
   04662 B cell receptor signaling pathway
    100359283 (NFKBIB)
   04062 Chemokine signaling pathway
    100359283 (NFKBIB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100359283 (NFKBIB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100359283 (NFKBIB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100359283 (NFKBIB)
  09172 Infectious disease: viral
   05162 Measles
    100359283 (NFKBIB)
   05164 Influenza A
    100359283 (NFKBIB)
   05169 Epstein-Barr virus infection
    100359283 (NFKBIB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100359283 (NFKBIB)
   05140 Leishmaniasis
    100359283 (NFKBIB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100359283 (NFKBIB)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    100359283 (NFKBIB)
SSDB
Motif
Pfam: Ank_2 Ank_3 Ank Ank_5 Ank_4
Other DBs
NCBI-GeneID: 100359283
NCBI-ProteinID: XP_002711503
Ensembl: ENSOCUG00000024218
UniProt: G1TL53
LinkDB
Position
5
AA seq 356 aa
MAGVACLGKGADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDT
ALHLAVIHQHEPFLDFLLGFSAGTEYLDLQNDLGQTALHLAAILGEASAVEKLYAAGAGV
CVAERGGHTALHLACRVGAHACACALLQPRPQRPGDTASLYLAQSPEPTSPVNHTSFAST
PEPDLEKEEEGREEDWKLQLEAENYDGHTPLHVAVIHRDAEMVRLLRDAGADLNKPEPTC
GRSPLHLAVEAQAADVLELLLRAGADPTARMYGGRTPLGSALLRPNPALARLLRAHGAPE
PADEDDKPGPCSSSSDSDSADEGTEYDDIVVHSGRSQTRPPPTPASKPPPDDPGST
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggctggggttgcgtgcttgggaaaaggtgcggacgcggatgaatggtgcgacagcggc
ctgggctctctggggccggacgcggcagccccaggaggcccggggctgggcgcagagctg
ggcccagggctatcgtgggctccgctcgtcttcggctacgtcactgaggatggcgacacg
gcgctgcacttggccgtgattcatcagcacgagcccttcttggatttcctcctgggcttt
tcagcgggcactgagtacctagatctgcagaatgacctcggccagacggccttgcacctg
gcagccatcctgggggaggcgtccgcggtggagaagctgtacgcggcgggcgccggggtg
tgcgtggcggagcgcgggggccacacagcgctgcacctggcctgccgcgtgggggcgcac
gcctgcgcgtgtgcgctgctccagcctcgcccccagcgccccggggacaccgccagcctc
tacctcgcccagagcccagagcccacctcccccgtcaaccacacctcctttgcctcgacc
cctgaacccgacttggagaaggaagaggagggccgcgaggaggactggaagctgcagctg
gaagccgaaaactatgacggccacaccccactccacgtggccgtcatccacagagacgca
gagatggtgcggctgctccgcgacgctggggctgacctcaacaaaccggagcccacgtgt
ggcaggagccccctgcacttggccgtggaggcccaggcagcggacgtgctggagcttctg
ctaagggcaggcgccgaccccaccgctcgcatgtacggtggccgcaccccgctgggtagc
gccctgctgcggcccaatcccgccctggcccgcctcctccgtgcacacggagcccccgag
cctgcggacgaggacgacaagcctggtccctgcagcagcagcagcgacagcgacagcgcg
gacgagggcacggaatacgacgacatcgtggtccatagcggccgaagccagacccggcca
cctcccaccccagcctccaagccccctcccgacgaccccggctccacctaa

DBGET integrated database retrieval system