KEGG   Oryctolagus cuniculus (rabbit): 100357449
Entry
100357449         CDS       T03373                                 

Gene name
NCBP1
Definition
(RefSeq) nuclear cap binding protein subunit 1
  KO
K12882  nuclear cap-binding protein subunit 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu03040  Spliceosome
ocu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100357449 (NCBP1)
  09122 Translation
   03013 RNA transport
    100357449 (NCBP1)
   03015 mRNA surveillance pathway
    100357449 (NCBP1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100357449 (NCBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100357449 (NCBP1)
   03041 Spliceosome [BR:ocu03041]
    100357449 (NCBP1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Cap binding complex
     100357449 (NCBP1)
Spliceosome [BR:ocu03041]
 Common components
  Common spliceosomal components
   Cap binding complex
    100357449 (NCBP1)
SSDB
Motif
Pfam: MIF4G_like_2 MIF4G_like MIF4G Jnk-SapK_ap_N DUF1690 Tropomyosin_1 DUF2524
Other DBs
NCBI-GeneID: 100357449
NCBI-ProteinID: XP_008261442
Ensembl: ENSOCUG00000013853
UniProt: A0A5F9D214
LinkDB
Position
1
AA seq 789 aa
MSRRRHSDENDGGQPHKRRKTDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADL
PNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNY
NEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLSSLPWVG
KELYEKKDAEMDRIFANTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLKK
DRWQERHILRPYLAFDSILCEALQHNLPPFTPPPHTEDSTYPMPRVIFRMFDYTDDPEGP
VMPGSHSVERFVIEENLHCIIKSHWKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELFQ
LPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMNTTCVDRFINWFSHHL
SNFQFRWSWEDWSDCLTQDLESPKPKFVREVLEKCMRLSYHQRILDIVPPTFSALCPANP
TCIYKYGDESSNSLPGHSVALCLAVAFKSKATNDEIFSILKDVPNPNQDDDDDEGFSFNP
LKIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDEGKLHVLRVMFEVWRNHPQMI
AVLVDKMIRTQIVDCAAVANWIFSSELSRDFIRLFVWEILHSTIRKMNKHVLKIQKELEE
AKEKLARQHKRRSDDDDRGSDRKDGALEEQIERLQEKVESAQSEQKNLFLVIFQRFIMIL
TEHLVRCETDGTSVLTPWYKNCIERLQQIFLQHHQIIQQYMVTLENLLFTAELDPHILAV
FQQFCALQA
NT seq 2370 nt   +upstreamnt  +downstreamnt
atgtcgcggcggcggcacagcgacgagaacgacggtggacagcctcacaaaaggagaaag
actgatgcaaatgaaactgaagatcatttggagtctttaatatgcaaagtaggagaaaag
agtgcctgctctttggagagcaacctagaaggtctggctggtgttttggaagctgatctt
cccaactacaagagcaagatcttaagacttctttgtacagttgcacgtctgttacctgag
aagttgacaatttatacaacgttggttggactgctgaatgccaggaattacaactttggt
ggagaatttgtagaagctatgattcgtcaacttaaagaatcattgaaagcaaacaattat
aatgaagctgtgtatttggtccgttttttgtctgatcttgtgaattgtcatgtgattgct
gccccatcaatggttgctatgtttgaaaattttgtaagtgtaactcaggaagaagatgtg
cctcaggtgcgacgggattggtacgtgtatgcatttctgtcgtcattgccctgggttgga
aaggagttgtacgaaaagaaagatgcagagatggaccgcatcttcgccaacactgaaagc
taccttaaaagacgccagaagactcatgtgcccatgctacaagtctggactgccgacaaa
ccgcacccacaggaagagtatttagattgcctgtgggcccagattcagaaattgaaaaag
gatcgctggcaggagcggcacatcctaagaccctatcttgcctttgacagtatcctgtgt
gaagcactgcagcacaatctgcctccgtttaccccccctccgcacactgaagactccacg
taccccatgcccagggtcatcttcagaatgtttgattacacagatgaccccgagggtcct
gtcatgccagggagtcattcagtggaaagattcgtaatagaagagaatcttcactgcatc
atcaagtcccactggaaggaaaggaagacttgtgctgcacagctagtgagctatccaggg
aagaacaagatccccttgaactaccacatcgttgaggtgatctttgcagagctgttccag
cttccagcaccacctcacattgatgtgatgtacacaacacttctcattgagctgtgcaaa
ctgcagcctggctctctaccccaagttcttgcacaggcaactgaaatgttatacatgcgt
ttggataccatgaacactacatgtgtagacaggtttattaattggttttctcatcatcta
agtaacttccagttccgctggagctgggaagattggtcagattgtcttactcaagatctt
gaaagtcccaaaccaaagtttgtaagagaagttctagaaaaatgtatgaggttgtcttac
catcagcgtatattagatattgttcctcctaccttctcagctctgtgtcctgcaaaccca
acctgcatttacaagtatggagatgaaagtagcaattctcttcctggacattctgtggcc
ctctgtttagctgttgcctttaaaagtaaggcaaccaatgatgaaatattcagcattctg
aaagatgtaccaaaccccaaccaggatgacgatgatgatgaaggattcagttttaacccg
ttgaaaatagaggtgtttgtgcagaccctgctgcacttggcagccaagtccttcagccac
tccttcagtgccctggccaagtttcacgaagtcttcaaaacactagcagaaagtgatgaa
ggaaagttacacgtgctgagggttatgtttgaggtttggaggaaccatccgcagatgatt
gctgtactggtggataagatgattcgtacacagattgttgattgtgctgcagtagcaaat
tggatcttttcttcagaactgtctcgtgattttattagattgtttgtttgggaaatcttg
cattctacgattcgtaagatgaacaaacacgttctgaagatccagaaagagctagaagaa
gctaaagagaaacttgcaaggcaacacaaacggcgaagtgacgatgacgacagaggcagt
gacagaaaagatggggcccttgaggagcaaatagagagactacaggaaaaagtggaatct
gctcagagtgaacaaaagaacctcttccttgtcatatttcagcgctttatcatgatcttg
actgaacatttagtacgatgtgagactgacgggaccagtgtgttgacgccatggtacaag
aactgtatagaaagactccagcagatcttccttcagcatcaccagataatccagcagtac
atggtgaccctggagaaccttctcttcactgctgaactagaccctcatatccttgctgtg
ttccagcagttctgtgctctgcaggcctag

DBGET integrated database retrieval system