KEGG   Oryctolagus cuniculus (rabbit): 100357494
Entry
100357494         CDS       T03373                                 

Gene name
POLH
Definition
(RefSeq) DNA polymerase eta
  KO
K03509  DNA polymerase eta [EC:2.7.7.7]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100357494 (POLH)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100357494 (POLH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100357494 (POLH)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100357494 (POLH)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    100357494 (POLH)
SSDB
Motif
Pfam: IMS zf_UBZ IMS_C Mnd1 IMS_HHH
Other DBs
NCBI-GeneID: 100357494
NCBI-ProteinID: XP_002714741
Ensembl: ENSOCUG00000005525
UniProt: G1SP42
LinkDB
Position
12
AA seq 687 aa
MSTGQDRVVVLVDMDCFFVQVEQRENPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVT
RSMWADDAKKLCPDLLLAQVRESHGKANLTKYREASVEVMEVMSRFAGIERASIDEAFLD
LTDAVEERLQKLQGQPISADLLPSTYIEGLPQGSTTAEETVQKEEMRKQGLLQWLGSLEI
EGTASPDVRLTMGAVIVEEMRAAIERKTGLQCSAGISHNKVLAKLACGLNKPNRQTLVSH
KFVPQLFSQVPIRKVRNLGGKLGSSVIAILGIEYMGELTQFTESQLQWHFGEKNGSWLYA
MCRGIEHDPVRPRQIPKSVGCSKNFPGQTALATPEQVQWWLLQLARELEERLTKDQTDND
RMATQLAVSIRVQGDKRLSSLRRCCAITRYDAHKMSQDAFAAIRNCNTSGLQTEWSPPLT
MLLLCATKFAASTPKVPSSSSEAKAPGSGPVVAATKKATTSLESFFQKAAEKQKVKEASS
LTTTAQAHTSSSPSKPSSALQTSRTAGVEPFFKQKSLLLQQKELHSSPCLPPQDPQPDCS
ALPAQDPHRAPACEGALKLEPAAAAPAQRDLAQNSSSLLAASASTCALDAAPGGSAAPSL
LAAEDLVSCEKCGSLVLVWEMPEHLDYHFALELHESFLQAHSSNPQVVPVKSPQGKRNPK
SPLASSNKRPRPQGMRTLESFFKPLAH
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgtctactggacaagatcgagtggtggttctggtggacatggactgtttttttgttcaa
gtggaacagcgggaaaatcctcatttgaggaataaaccttgtgcagttgtgcaatacaaa
tcatggaaaggtggtggaataattgcagtgagttatgaagctcgagcgtttggggtcact
agaagtatgtgggcagatgatgcaaagaagttatgcccagatcttcttctggcacaagtt
cgtgagtcccatgggaaagccaacctcaccaagtatcgagaagccagtgttgaagtgatg
gaggtaatgtctcgttttgctgggatcgaacgtgccagcattgatgaggcttttctagat
ctgactgatgctgtggaagagagactgcagaaactacaaggtcagcctatctcagcagac
ttgttgccaagtacttacattgaagggttgcctcaaggctctacaacagcagaagagact
gttcagaaagaggagatgcgaaaacaaggcttactccagtggctcgggtctctggaaatt
gaaggcacagcctctccagatgtgcggctcaccatgggggctgtgattgtggaggagatg
agggcggccatagagaggaagactggcttgcagtgttcagctggaatctcacacaataag
gtcttagcaaaattggcctgtggactaaacaagcccaaccgccagaccttggtctcacac
aagttcgtcccacagctcttcagtcaagtgcctattcgcaaagtccgtaatctcggagga
aagcttgggtcctctgtcattgcaatcctagggatagagtacatgggtgaactgacacag
ttcactgaatcccagctccagtggcattttggggagaagaatgggtcttggctatatgcc
atgtgccgcgggattgaacacgatccagtgaggcccaggcagatacccaaaagcgttggc
tgtagcaagaacttccctggacaaacggctctggccaccccggaacaggtgcaatggtgg
cttttgcagttagcccgggaactagaggagagactgactaaagaccaaactgataatgac
aggatggccacccagttggctgtgagcattcgtgtacaaggagacaaacgtctgagcagc
ctgcgccgctgctgtgccattactcgctatgatgctcacaagatgagccaggatgccttt
gctgccatcaggaactgtaatacttctggactccagactgaatggtccccccccctcaca
atgcttctcctctgtgctaccaaattcgctgcctccaccccaaaggtgccgagcagcagt
tcagaagctaaggccccggggagcggcccagtggtggcagccactaagaaagcaactact
tctctggaatcattcttccaaaaagctgcagaaaagcagaaagtcaaagaagcttcatcc
cttaccaccactgcccaggcccacacaagcagttcaccctccaagccctcgtcagctctc
caaaccagtagaactgcaggagtggagcccttctttaagcagaaaagcctgcttctacag
cagaaagagcttcattcttcaccgtgtctcccgccgcaagatcctcagcccgactgtagc
gcgttgcctgcacaagatccacaccgtgcccctgcttgtgaaggggcgttgaaattggaa
cctgctgcagcagctcccgcgcagagggatttggctcaaaacagctcaagcctgctcgct
gcctctgcttccacgtgtgctctggacgcggctcccggaggaagtgctgccccgagtctt
ctcgctgctgaggacctagtgtcctgtgagaagtgcggctccctggtgctggtgtgggag
atgccggaacacctcgactatcattttgcactggagctacacgaatccttcttgcaggca
cactcctcaaacccccaggttgttcccgtcaagtctcctcaaggcaaaagaaatcccaag
agtcctttggcttccagtaataaacgccccaggcctcaaggcatgcggacactggaatca
ttttttaaaccattagcacactag

DBGET integrated database retrieval system