KEGG   Oryctolagus cuniculus (rabbit): 100357703
Entry
100357703         CDS       T03373                                 

Gene name
BBC3
Definition
(RefSeq) BCL2 binding component 3
  KO
K10132  Bcl-2-binding component 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04390  Hippo signaling pathway
ocu05016  Huntington disease
ocu05162  Measles
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100357703 (BBC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100357703 (BBC3)
   04215 Apoptosis - multiple species
    100357703 (BBC3)
   04115 p53 signaling pathway
    100357703 (BBC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100357703 (BBC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100357703 (BBC3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100357703 (BBC3)
  09172 Infectious disease: viral
   05162 Measles
    100357703 (BBC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100357703 (BBC3)
SSDB
Motif
Pfam: PUMA ER-remodelling DUF3886 SIP1
Other DBs
NCBI-GeneID: 100357703
NCBI-ProteinID: XP_017194298
LinkDB
Position
Un
AA seq 150 aa
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLLRASPSAPQGPQPSLSPAEQS
LESPCPAPRGPLEGVPTPAAPGVWGEEEQWAREIVAQLRRMADDLNAQYERRRQEEQQRH
RPSPWRVLYNLLMGLLPLPRGPGAPEMEPN
NT seq 453 nt   +upstreamnt  +downstreamnt
atggcccgcgcacgccaggagggcagctctccggagcccgtagagggcctggcccgcgac
ggccctcgccccttcccgcttggtcgcctggtgccctcggccgtgtcctgcggccttctg
cgagccagcccctctgccccccaaggtccccagccgtcgctgtccccggccgagcagtca
ctggagtcgccgtgcccagcgccccgggggcccctggagggggtccccaccccggcggcc
ccgggagtctggggcgaggaggagcagtgggcccgagagatcgtggcccagctgcggcgg
atggcggacgacctgaacgcgcagtacgagcggcggagacaagaggagcagcagcgacac
cgcccttcgccctggagggtcctgtacaatcttctcatgggacttctgcccttacccagg
ggccccggagccccggagatggagcccaactag

DBGET integrated database retrieval system