KEGG   Oryctolagus cuniculus (rabbit): 100357969
Entry
100357969         CDS       T03373                                 

Gene name
GTSE1
Definition
(RefSeq) G2 and S-phase expressed 1
  KO
K10129  G-2 and S-phase expressed protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100357969 (GTSE1)
SSDB
Motif
Pfam: GTSE1_N
Other DBs
NCBI-GeneID: 100357969
NCBI-ProteinID: XP_008249900
Ensembl: ENSOCUG00000000377
LinkDB
Position
Un
AA seq 724 aa
MDVPEEEGILLLTDEKFDFDLSLSSSSANEDDEVFFGPVGHKERCIAASLELNKASPGPP
PLPASGGPFAWSPLAGEKFVEVYKEARLLALQIESSSRNRAAHMSKPQDAGSLGVERFLQ
ESQLKVSLFEKEKEKEKSPKSLKRETYYLSNSPLVGPLLLDNQPSMSEAPRPTRPSSAAQ
VGPVQSQGPLHSSRPWSGQPGAAHPPNQAVAQKRVPSKLQLPRASSSVRGKSLHSATEKL
KKELPTSPSKTKTLKGKEPCREAPPDQPGMALDTASLPASGSHLVQGKRLLSVPPKSGLR
KSLLKPPGCNLARKSSSSGSVSSEMSGACVSPAVGKAKRREFTSVPAHSSLPLSNTGKLG
RTGPKAPHQSLPAAGTDIAECTTEQPTVPTTAAATQPQTPGGRDPRLDSNSILSESSQLN
KTGSIRRRDSHLNSATKVMPTPTNPFKIPKSSIGGSPDGTTPKFSRTQRPQSCVSAGRAV
VHSTPVRCSLGLASPGLASSSRPPLSSRRMSSLPTPTGRRLSSLAWDTPKTVPRALVSPL
PVPTRRLSSEPRKKSAVRTEPTTTTWRADSEPGARSPEGRLSPHPSAVPQALNFSPEKSD
FTLPKSTSTEATLDEAKSSADARPGEALLVDIRLDQLTITMEAESRALCDRPLIDFCSTP
EGSVALGSESRPLIDLMTNTPDLSGGVPSKPSQVVGQLIDLSSPLIQLSPAADKENVDSP
LLKF
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggacgtccctgaggaggaaggcatcctgcttttgactgatgaaaaatttgacttcgat
ctctcattgtcttcttcaagtgcaaatgaagacgatgaagtgttttttgggcctgttggg
cataaagaaagatgtattgctgccagcctagaactcaacaaggcaagtccaggcccacct
cctctgccagcatctggaggcccctttgcatggagccccctggccggggagaagttcgtg
gaggtctacaaggaagcgcgcttgctggccttgcagatagagagcagcagcaggaacagg
gcagcccacatgtccaagccccaggacgccgggagcctgggtgtggaaagattcctacag
gagtcacaattaaaagtgagcctctttgagaaagaaaaggaaaaggagaagagtcccaag
tcacttaaaagggagacttactacctgtccaacagccccttggtgggaccactgctcttg
gacaaccagccctccatgagtgaggccccgcgcccgacccggcccagctctgctgcccag
gtcggccccgtccagtcacaggggccattgcactcgtctcgtccttggtcagggcagcct
ggtgctgcccaccctcccaaccaggcagtggcacagaaaagggtccccagcaaactgcag
ctgcctcgagcatcatcgtctgtcagaggaaagagcctccactcggccaccgagaagctc
aagaaagagctaccgactagtccatccaagacaaaaaccctaaaaggaaaggaaccctgc
agggaagcaccccctgaccaacctggcatggctctggacacggccagtttgccggccagt
ggaagccacctggtgcaaggcaagcgattgctctctgttcctcccaagtcagggctgagg
aagagcctgttgaaaccaccgggctgcaatctggccaggaagtcctcttcgtcaggctct
gtttccagtgagatgtccggtgcgtgtgtgtctccagcggtaggcaaagctaaacgaagg
gaatttacaagcgttcctgcccacagctccttgcctctgtcaaacactggcaagttgggc
agaacaggccccaaggcaccgcaccagtctctgccagcagcaggtaccgacattgctgag
tgcaccacggagcaacccacagtgcccaccacagctgctgccacccagccccagacccca
ggaggtagagacccgaggctggactctaattctattctgtcggaatcatctcaactgaat
aaaactggaagtataagaaggcgagattcccatctaaattctgcaacaaaggttatgcct
actcctacaaatccatttaaaattcctaagtcttctattggtggttccccggatggtaca
acaccaaagttctctcggacgcaaaggccgcagtcctgtgtgtcggctggaagggctgtt
gtccatagcactcctgtgagatgctccttggggctggcttcaccaggcctggccagcagt
tcacggcctcccctgagctcaaggcgcatgtcatccttgcccacacccactggccgccgc
ctctccagccttgcatgggataccccaaagactgtgcccagggccctggtctcacccctg
cctgtgcctactcggcgactttcttcagagccccggaagaaatctgcagtgagaactgaa
ccgacaacgacaacgtggagggctgactctgagcctggagcgaggtcgccagagggaagg
ttatctccacatccatctgctgtgcctcaagcgcttaacttttctccagaaaaaagcgat
tttactcttccaaaaagcaccagcactgaagcaactctggatgaagcaaagtcaagtgca
gatgcgcgccctggagaggcccttctcgtggacatcaggctggaccagctcaccatcacc
atggaagcggaaagcagagccctctgtgaccgccctctcatcgacttctgcagcacccca
gaaggcagcgtggctctggggtctgagagccgacctctgatcgacctcatgacaaacacc
ccagacctgagtggaggtgttccgtctaaaccttcacaggtagtggggcagctcattgac
ctgagctcccctctcatccagctgagccctgctgccgacaaggaaaatgtggattcgcca
cttctcaagttctga

DBGET integrated database retrieval system