KEGG   Oryctolagus cuniculus (rabbit): 100358109
Entry
100358109         CDS       T03373                                 

Gene name
WDR5B
Definition
(RefSeq) WD repeat domain 5B
  KO
K14963  COMPASS component SWD3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100358109 (WDR5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100358109 (WDR5B)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    ATAC complex
     100358109 (WDR5B)
    NSL complex
     100358109 (WDR5B)
   HMT complexes
    COMPASS/SET1 complex
     100358109 (WDR5B)
    COMPASS/SET1 complex (yeast)
     100358109 (WDR5B)
    MLL-HCF complex
     100358109 (WDR5B)
    MLL3/MLL4 complex
     100358109 (WDR5B)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Nup160 WD40_like Ge1_WD40
Other DBs
NCBI-GeneID: 100358109
NCBI-ProteinID: XP_002716674
UniProt: A0A5F9C3C7
LinkDB
Position
14
AA seq 329 aa
MATDEPGDAKAQSQVSASSQRQQVPAKPHYALSSTLAGHTQAVSSVKFSPNGEWLASSSA
DKRIIIWGAYDGKLEKTLYGHRLEISDVAWSSDSSRLVSASDDKTLKIWDVSSGKCWRTL
KGHNNYVFCCNFNPASNLIVSGSFDESVKIWEVKTGKCLKTLCAHSDPVSAVHFNCSGSL
IVSGSYDGLCRIWDAASGQCLKVLVDDVNPPVSFVTFSPNGKYILTATLDNSLKLWDYSR
GRCLKTYTGHKNEKYCVFASFSVTGGKWVVSGSEDNLVYIWNLQTKEIVQKLQSHTDVVI
SVACHPTQNIIASAALENDKTIKLWMSNY
NT seq 990 nt   +upstreamnt  +downstreamnt
atggcaacagacgagccaggagacgctaaggcccagtcccaagtctcagcttccagtcag
cgccagcaggtgcctgcaaagccccactatgcgctcagctccaccctcgcgggacacacg
caggcggtgtcgtcggtcaagtttagtcctaacggagagtggctagccagctcctctgct
gataaacgaattataatttggggagcatatgatggaaaacttgaaaaaaccctgtatggt
cacagactggagatctcagacgttgcttggtcgtcggattccagtcgtcttgtttctgct
tcagatgataagacgctgaagatatgggatgtgagctctgggaaatgctggagaacactg
aaggggcacaacaattatgtcttctgctgtaatttcaaccccgcgtccaacctcatcgtt
tctgggtctttcgacgagagtgtgaaaatatgggaggtgaaaacagggaagtgccttaag
actttgtgtgctcattctgacccggtgtctgcagtgcattttaactgcagtgggtccttg
atagtgtcaggtagctatgatggtctctgtagaatctgggatgctgcatcaggtcagtgt
ttaaaagtgcttgttgatgatgtcaaccctcctgtctcctttgtaacattttctccaaat
ggtaaatatattctcactgcgactttggacaattctcttaaactgtgggattatagcaga
ggcagatgcctgaagacatacacagggcataaaaatgagaagtattgcgtatttgccagt
ttctcagttactggtgggaagtgggttgtgtccggttcagaggataacctggtttacatc
tggaaccttcaaactaaggagattgtgcagaaattacagagtcacacagatgtcgtaatc
tcagtggcttgtcatcctacacaaaacatcattgcatcggcagcattagaaaatgacaaa
acaattaaactctggatgagtaactactga

DBGET integrated database retrieval system