KEGG   Oryctolagus cuniculus (rabbit): 100358445
Entry
100358445         CDS       T03373                                 

Gene name
RARB, RARbeta
Definition
(RefSeq) retinoic acid receptor beta
  KO
K08528  retinoic acid receptor beta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05200  Pathways in cancer
ocu05222  Small cell lung cancer
ocu05223  Non-small cell lung cancer
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100358445 (RARB)
  09162 Cancer: specific types
   05226 Gastric cancer
    100358445 (RARB)
   05222 Small cell lung cancer
    100358445 (RARB)
   05223 Non-small cell lung cancer
    100358445 (RARB)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    100358445 (RARB)
Nuclear receptors [BR:ocu03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   100358445 (RARB)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 100358445
NCBI-ProteinID: XP_002716266
Ensembl: ENSOCUG00000000714
UniProt: G1SDW7
LinkDB
Position
14
AA seq 448 aa
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtttgactgtatggatgttctgtcagtgagtcctgggcaaatcctggatttctacacg
gcaagtccgtcttcctgtatgctccaggagaaagctctgaaagcatgcttcagtggattg
acccaaaccgagtggcagcatcggcacactgctcaatccatcgaaacccagagcaccagc
tctgaggaactcgtcccgagccccccgtctccactgcctccccctcgcgtgtacaagccc
tgcttcgtctgccaggacaaatcatcggggtaccactatggggtcagcgcctgcgagggc
tgcaaggggtttttccgcagaagtattcagaagaacatgatttacacttgtcaccgagat
aagaactgtgttattaataaagtcaccaggaatcgatgccagtactgtcggctccagaag
tgctttgaagtgggaatgtccaaagaatctgtcaggaatgacaggaacaagaagaagaag
gagccttcgaagcaggaatgcacagaaagctatgaaatgacagccgagctggacgacctc
acagagaagatccgcaaggctcaccaggaaaccttcccctcgctctgccagctgggcaaa
tacaccacgaattccagtgctgaccatcgtgtccggctggacctgggcctctgggacaaa
ttcagcgagctggccaccaagtgcattattaagattgtggagtttgctaagcgtctgccc
ggcttcactggcttgaccatcgcagaccaaatcaccctgctcaaggccgcctgcctggac
atcctgattctgagaatttgcaccaggtacaccccagagcaagacaccatgactttctca
gatggccttaccttaaaccgaactcagatgcacaatgctggatttgggcctctcactgac
ctcgtgttcacctttgccaaccagctcctgcctttggaaatggatgacacagaaacaggc
cttctcagtgccatctgcctcatctgtggagaccgccaggaccttgaagaaccaacaaaa
gtagataagctacaagaaccgttgctggaagcactaaaaatttatatcagaaaaagacga
cccagcaagcctcacatgttcccaaagatcttaatgaaaatcacagatctccgcagcatc
agtgctaaaggtgcagaacgtgtaattaccttgaaaatggagattcctggatcaatgcca
ccgctcattcaggaaatgctggagaattcggaaggacatgaacccttgaccccaagttca
agtgggaacacagcagagcacagtcccagcatctcacccagctcagtggaaaacagcggg
gtcagtcagtcaccactggtgcaataa

DBGET integrated database retrieval system