KEGG   Oryctolagus cuniculus (rabbit): 100358566
Entry
100358566         CDS       T03373                                 

Gene name
HNRNPUL1
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein U like 1
  KO
K15047  heterogeneous nuclear ribonucleoprotein U-like protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100358566 (HNRNPUL1)
SSDB
Motif
Pfam: AAA_33 SPRY SAP SAP_new25 AAA_18 SRP54
Other DBs
NCBI-GeneID: 100358566
NCBI-ProteinID: XP_008247928
Ensembl: ENSOCUG00000016666
UniProt: G1TC48
LinkDB
Position
Un
AA seq 856 aa
MDVRRLKVNELREELQRRGLDTRGLKAELADRLQAALEAEEPDDERELEADDEPGRPGHN
NEEVETEGGSELEGTAQPPPPGLQPHPEPGGYSGPDGHYVMDNITRQNQFYETQVIKQEH
ESAYERRALDMEPQQQSHRPEGKTEMKQEGPTSFLPPEAPQLKPDRQQFQSRKRPYEENR
GRGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVARDRSSGYPLTIEGF
AYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEP
FSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQ
KEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPKSKA
ECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDV
LIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLK
DRTIKRTDEEGKDVPDHAVLEMKANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEEGR
KAGPPPEKRFDNRGGGFRGRGGGGGFQRYDNRGPPGGSRGGFQNRGGGSGGGGSYRGGFN
RSGGGGYNQNRWGNNSRDNNNSNNRGSYNRAPQQQPPPQQPPPPQPPPQQPPPPPSYSPA
RNPPGASSYSKNSSIPGASASTSTPTVSSYSPPQPSYSQPPYNQGGYSQGYTAPPPPPPP
PPAYNYGSYGGYSPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNY
DYGSYSGSTQGGASTQ
NT seq 2571 nt   +upstreamnt  +downstreamnt
atggatgtacgccgtctgaaggtgaacgaacttcgcgaggagctgcagcgccgcggcctg
gacactcgcggccttaaggccgagcttgctgaccggctgcaggctgcgctggaggccgag
gagcccgacgacgagcgggagctcgaggccgacgacgaaccggggcgacctgggcacaac
aacgaggaggtcgagaccgaggggggctccgagctggaggggaccgcgcagccaccgccg
cccgggctgcagccgcacccggagcccggcggctactcggggccggacggacattatgtc
atggacaatattaccaggcagaaccagttctatgagacccaggtcatcaagcaagagcat
gagtctgcctatgagaggagagcactagacatggagccgcagcagcagtcccatcgccca
gaagggaagacagagatgaaacaagaaggacccaccagcttcctcccgcctgaagctcct
cagctcaagcccgacagacagcagttccagagtcgcaagaggccttacgaagaaaaccgg
ggccgcgggtactttgagcaccgagaggatcggaggggccgctcccctcagcctcccgcc
gaagaggatgaagacgactttgatgacacccttgttgccatcgatacatataactgcgac
ctccacttcaaggtggcccgagataggagtagtggctatccgctcacaatcgagggcttt
gcatacctttggtcaggagcccgtgccagctacggggtcaggaggggccgtgtgtgcttc
gagatgaagatcaacgaggaaatctctgtgaagcaccttccgtctacagagcccgatccc
cacgttgttcgaatcggctggtccctggactcctgcagcacccagctaggtgaagagcct
ttctcctatggctacggaggcactggaaagaagtccaccaatagccgatttgaaaactac
ggagacaagtttgcagagaacgatgtgattggctgctttgcggactttgaatgtggaaac
gatgtggaactttccttcaccaagaatgggaagtggatgggcattgccttccgaatccag
aaggaggccctggggggtcaggccctgtatcctcatgtcctggtgaagaactgtgccgtg
gagttcaacttcggacagagggcagagccctactgttctgtcctcccaggattcaccttc
atccagcaccttcccctcagcgagcggatccgcggcaccgttggaccaaagagcaaggca
gaatgtgagattctgatgatggtgggcctacctgctgctggcaagaccacttgggccatc
aaacatgcagcctccaacccttccaagaagtacaacatcctgggtaccaatgccatcatg
gataagatgcgggtgatgggcctgcgccgacagcggaactacgctggccgctgggacgtc
ctgatccagcaggccacccagtgcctcaaccgcctcatccagatcgctgcccgcaagaaa
cgcaactatatcctagaccagacaaatgtttatgggtcagcccagagacgaaaaatgaga
ccatttgaaggcttccagcgcaaagccattgtaatttgtcccactgacgaggacctaaaa
gaccgaacaataaagcgaaccgacgaggaagggaaggatgtccccgaccatgcggtctta
gaaatgaaagccaacttcaccttgccggacgtcggggacttcctggatgaggttctgttc
atcgagctgcagcgggaggaagccgacaagctggtgaggcagtacaatgaggaaggccgc
aaggccgggccgcccccggagaaacgctttgacaaccgaggtggcggcttccggggccga
ggaggtggcggcggcttccagcgctatgacaaccgaggtccccctggaggcagccgcgga
ggcttccagaaccgaggtggaggcagcggtggagggggcagctaccgaggaggtttcaac
cgcagtggaggtggtggctacaaccagaaccgctggggtaacaacagccgggataacaac
aactccaacaaccgaggcagctacaaccgggccccccagcaacagccgccacctcagcag
ccgccgccgccacagccgcccccacagcagccgccgccgccgcccagctacagccctgct
cggaaccccccgggggccagcagctacagtaagaacagcagcatccctggcgccagcgcc
agcaccagcacccccaccgtcagcagctacagccctccacagccgagttacagccagcca
ccctacaaccagggaggttacagccagggctacacagcaccaccgcctccacctccgcca
ccgcctgcctacaactatgggagctacggtggctacagcccggccccctataccccaccg
ccacccccaactgcacaaacctaccctcagcccagctataaccagtatcagcagtatgcg
cagcagtggaaccagtactatcagaaccagggccagtggccaccatactacgggaactac
gactacgggagctactccgggagcacacagggaggcgcaagtacacagtag

DBGET integrated database retrieval system