KEGG   Oryctolagus cuniculus (rabbit): 100358587
Entry
100358587         CDS       T03373                                 

Gene name
BAD
Definition
(RefSeq) BCL2 associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu01524  Platinum drug resistance
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04140  Autophagy - animal
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04370  VEGF signaling pathway
ocu04510  Focal adhesion
ocu04722  Neurotrophin signaling pathway
ocu04910  Insulin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu05010  Alzheimer disease
ocu05014  Amyotrophic lateral sclerosis
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05165  Human papillomavirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05223  Non-small cell lung cancer
ocu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100358587 (BAD)
   04014 Ras signaling pathway
    100358587 (BAD)
   04370 VEGF signaling pathway
    100358587 (BAD)
   04024 cAMP signaling pathway
    100358587 (BAD)
   04022 cGMP-PKG signaling pathway
    100358587 (BAD)
   04151 PI3K-Akt signaling pathway
    100358587 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100358587 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    100358587 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100358587 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100358587 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100358587 (BAD)
   04919 Thyroid hormone signaling pathway
    100358587 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100358587 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100358587 (BAD)
   05203 Viral carcinogenesis
    100358587 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100358587 (BAD)
   05212 Pancreatic cancer
    100358587 (BAD)
   05225 Hepatocellular carcinoma
    100358587 (BAD)
   05221 Acute myeloid leukemia
    100358587 (BAD)
   05220 Chronic myeloid leukemia
    100358587 (BAD)
   05218 Melanoma
    100358587 (BAD)
   05211 Renal cell carcinoma
    100358587 (BAD)
   05215 Prostate cancer
    100358587 (BAD)
   05213 Endometrial cancer
    100358587 (BAD)
   05223 Non-small cell lung cancer
    100358587 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100358587 (BAD)
   05014 Amyotrophic lateral sclerosis
    100358587 (BAD)
   05020 Prion disease
    100358587 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    100358587 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100358587 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100358587 (BAD)
   05161 Hepatitis B
    100358587 (BAD)
   05160 Hepatitis C
    100358587 (BAD)
   05162 Measles
    100358587 (BAD)
   05168 Herpes simplex virus 1 infection
    100358587 (BAD)
   05165 Human papillomavirus infection
    100358587 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100358587 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100358587 (BAD)
   01524 Platinum drug resistance
    100358587 (BAD)
   01522 Endocrine resistance
    100358587 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 100358587
NCBI-ProteinID: XP_002724496
Ensembl: ENSOCUG00000006996
LinkDB
Position
Un
AA seq 157 aa
MFQIPEFEPSEQEDSSSAERGLGPSPTGDRPSGPRGDASHQQRQPSRSSHHGGAGAMETR
SRHSSYPADADDSEGAEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSVKGLPR
PKSAGTAMQMRESSSWTRVIQSWWDRNLGKGGSAPSQ
NT seq 474 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcccagtgagcaggaagactccagctctgccgagagg
ggcctgggccccagccccacaggggaccggccctcaggcccccggggggacgccagtcac
cagcagcggcagccgagccgcagcagccaccatggaggcgccggagctatggaaacccgg
agccgccacagctcgtaccctgcggacgcggacgacagcgaaggggccgaggaggagccc
agcccctttcggggccgctcgcgctcggcgccccccaacctctgggctgcacagcgctac
ggccgcgagctccgaaggatgagcgacgagttcgagggctccgtcaagggactgcctcgc
ccgaagagcgcgggcacagcgatgcagatgagggaaagctccagctggacgcgcgtcatc
cagtcttggtgggatcgcaatttggggaaaggaggctccgccccttcccagtga

DBGET integrated database retrieval system