KEGG   Oryctolagus cuniculus (rabbit): 100358763
Entry
100358763         CDS       T03373                                 

Gene name
IRF7
Definition
(RefSeq) interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100358763 (IRF7)
   04621 NOD-like receptor signaling pathway
    100358763 (IRF7)
   04622 RIG-I-like receptor signaling pathway
    100358763 (IRF7)
   04623 Cytosolic DNA-sensing pathway
    100358763 (IRF7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100358763 (IRF7)
  09172 Infectious disease: viral
   05162 Measles
    100358763 (IRF7)
   05164 Influenza A
    100358763 (IRF7)
   05161 Hepatitis B
    100358763 (IRF7)
   05160 Hepatitis C
    100358763 (IRF7)
   05168 Herpes simplex virus 1 infection
    100358763 (IRF7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100358763 (IRF7)
   05169 Epstein-Barr virus infection
    100358763 (IRF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100358763 (IRF7)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    100358763 (IRF7)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 100358763
NCBI-ProteinID: XP_008251920
Ensembl: ENSOCUG00000002339
UniProt: G1SHC1
LinkDB
Position
Un
AA seq 438 aa
MASAPEGRPPRVLFGEWLLQQVSSGRYEGLCWLNEARTRFRVPWKHFARRDLSEADARIF
KAWAVARGRWPPSRLEGDQLPPEAAERAGWKTNFRCALKSTRRFVMLRDNSTDPADPHKV
FELSPTPRGREDPGVEEEDALQDAPPTQGGAPTPFLAGGAAAAPCGDILLEALQSCLGEE
WGADPAPPQALGPALPVEVSPACTAEGVLSPEPPARALMTEPSPGVLDVTIMYKGRTVLQ
EVVGRPSCVFLYGPPSPAVAGAGPQQVAFPSPAELADQQQLRYTEELLRHVAPGLQLELR
GWGLWALRMGKCKVYWEVGGPLGCDRPCSPARPLARNCHTPIFDFSTFFQELAEFRARRR
KDSPRYTIYLGFGQDLSASRPKDKSLVLVKLEPWLCRAHLEGVQREGVSSLDGGSLSLCL
SSTNSLYDDIERFLMELG
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggcctccgctcccgaggggcggcctccgcgcgtgctcttcggggagtggctcctgcaa
caggtcagcagcggccgctacgaggggctgtgctggctgaacgaggcccgcacgcgcttc
cgcgtgccctggaagcacttcgcgcgcagggacctgagcgaagccgacgcgcgcatcttc
aaggcctgggcggtggcccgcggtaggtggccgcccagccgcctcgaaggtgaccagctg
cccccagaagcggctgagcgcgctggctggaaaaccaacttccgctgcgcgctgaagagc
acgcgacgcttcgtgatgctgcgcgataactccacggaccccgcagacccgcacaaggtg
ttcgagctgagccccacgccgcgcgggagagaagacccaggcgtggaggaggaagatgct
ctccaagatgccccacccacacagggcggggcccccacgccattcctggccggaggagca
gcggccgccccctgcggggacatcctgctggaggctctgcagagctgcctgggggaagag
tggggggcagacccagcccctccacaggctctgggcccagcgctccctgttgaagtgtcc
ccagcgtgcacagcagagggcgttctgagcccagagcccccggcccgggccctgatgaca
gagcccagcccaggcgtcctggacgtgaccatcatgtacaaggggcgcacggtgctgcag
gaggtggtggggcgcccgagctgcgtgttcctgtacgggccccccagccccgcggtggca
ggggcagggccacagcaggtggccttccccagcccggctgagctggcggaccagcagcag
ctgcggtacacggaggagctgctgcggcacgtggcgcccgggctgcagctggagctgcgg
ggctgggggctgtgggccctgcgcatgggcaagtgcaaggtgtactgggaggtgggcggc
cccctgggctgcgaccgcccctgcagccccgcccggccgctggcgcgcaactgccacacc
cccatcttcgacttcagcaccttcttccaagagctggcagagttccgggcacggcggcgc
aaggactccccacgctacaccatctacctgggcttcgggcaggacctgtcggccagcagg
cccaaagacaagagcctggtcctggtcaagctggagccgtggctgtgccgtgcacacctg
gagggggtgcagcgggagggcgtgtcctccctggacggcggcagcctgagcctgtgcctg
tccagcaccaacagcctgtacgacgacattgagcgcttcctcatggagctggggtag

DBGET integrated database retrieval system