KEGG   Oryctolagus cuniculus (rabbit): 100358822
Entry
100358822         CDS       T03373                                 

Gene name
STK4
Definition
(RefSeq) serine/threonine kinase 4
  KO
K04411  serine/threonine kinase 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04068  FoxO signaling pathway
ocu05200  Pathways in cancer
ocu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100358822 (STK4)
   04014 Ras signaling pathway
    100358822 (STK4)
   04068 FoxO signaling pathway
    100358822 (STK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100358822 (STK4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100358822 (STK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100358822 (STK4)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: STE group
  STE20 family
   100358822 (STK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Mst1_SARAH Pkinase_fungal Abi_2 Haspin_kinase Prothymosin DUF4611
Other DBs
NCBI-GeneID: 100358822
NCBI-ProteinID: XP_002721275
Ensembl: ENSOCUG00000003016
UniProt: G1SIV1
LinkDB
Position
Un
AA seq 487 aa
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQ
VPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LTEDEIATVLQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK
RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVRNAKGVSMLRDLINEAMDV
KLKRQESQQREVDQDDEDNSEEDEMDSGTMVRAAGDEMGTVRVASTMSDGASTMIEHEDT
LPSQLGTMVINAEDEEEEGTMKRRDETMQPVKPSFLEYFEQKEKENQVNSFGKSVPAPLK
NSSDWKVPLDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK
KRRQQNF
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggagacggtgcagctgaggaacccgccgcgccggcagctgaaaaagttggatgaagac
agtttaaccaaacaaccagaagaagtatttgatgtcttggagaaacttggagaagggtcc
tatggcagcgtgtataaagctattcataaagagaccggacagattgtggctattaaacaa
gttcctgtagaatcagatcttcaggagataatcaaagaaatctccataatgcagcaatgt
gacagccctcatgtagtcaaatattatggaagttattttaaaaacacagacttatggatc
gttatggagtactgtggagctggctctgtatctgatatcattagattacgaaataaaacg
ttaacagaagatgaaatagctacagtattacaatcaactcttaaaggattggaatacctt
cattttatgagaaaaatacaccgagacatcaaggcaggaaatattttgctaaatacagag
ggacatgcaaaactcgcggattttggtgtagcaggtcaacttacagataccatggccaag
cgtaatacagtaataggaacaccattttggatggctccagaggtgattcaggaaatcggg
tacaactgtgtggcagacatctggtctctgggaataactgccatagaaatggctgaagga
aagccaccatatgctgatatccatcccatgagggcaatcttcatgattcctacaaaccct
ccgcccacattccgcaaaccagagctgtggtcagataactttacggacttcgtgaagcag
tgtcttgtaaagagccctgagcagagggccacagccactcagctcctacagcacccgttt
gtcaggaatgctaaaggagtgtcaatgttgcgggacttaattaacgaagccatggatgtg
aaactgaaacgccaggaatcccagcagcgggaagtggaccaagatgatgaagataactca
gaggaggatgaaatggattctggcacgatggttcgcgcggcgggcgacgagatgggcact
gtgcgtgtggccagcaccatgagtgatggagccagtaccatgattgagcatgaagacacc
ttgccctcacagctgggcaccatggtgatcaatgcagaggatgaggaagaggaagggact
atgaaaagaagggatgagaccatgcagcctgtaaaaccatctttccttgaatactttgaa
caaaaagaaaaggaaaaccaggtcaacagctttggcaagagtgtacctgctccactgaaa
aattcttccgattggaaagtaccgctggatggagactatgagtttcttaagagttggaca
gtggaggaccttcagaagaggctcttggccctggaccccatgatggagcaggagatcgaa
gagatccgacagaagtaccagtccaagcggcagccaatcctggatgccattgaggctaag
aagaggcggcagcaaaacttctga

DBGET integrated database retrieval system