KEGG   Oryctolagus cuniculus (rabbit): 100358964
Entry
100358964         CDS       T03373                                 

Gene name
ZMAT3
Definition
(RefSeq) zinc finger matrin-type 3
  KO
K10137  zinc finger, matrin type 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100358964 (ZMAT3)
SSDB
Motif
Pfam: zf-C2H2_jaz zf-met zf-C2H2_2 TUTase zf-U1
Other DBs
NCBI-GeneID: 100358964
NCBI-ProteinID: XP_002716484
Ensembl: ENSOCUG00000004658
UniProt: A0A5F9CZU7
LinkDB
Position
14
AA seq 288 aa
MILLQHAGLPPPKRPSSSPPMSVATRSTGTLQLQPQKPFGQEASLPLAGEEELPKGGDQD
TALEELCKPLYCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPTRMSNVAEPT
ATPVVPVPPQVGSFKPGGRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEA
QSHSFSESSEVGPRRTRKEGNDFKMMPNRRNMYTVQNNSGPYFNPRSRQRIPRDLAMCVT
PSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYV
NT seq 867 nt   +upstreamnt  +downstreamnt
atgatcctcttgcaacacgccgggcttcctccacctaagaggccctcatcctctcctcct
atgtcagtggccaccaggtctacaggaaccttgcagcttcagccacagaagccttttggg
caggaggcttccttgcctttggctggagaagaagagttacctaaaggaggggaccaagac
actgccctggaggagctatgtaagcctctatactgcaaactctgcaatgtcaccttgaat
tcagcgcaacaggcccaggctcattatcagggtaaaaatcatggtaagaaactccgaaat
tactatgctgctaatagctgccctcctcctaccagaatgagcaatgtggcagagcctact
gccactccagttgttccagtccctccacaggtgggctcctttaagccgggaggccgagtg
atcctggccactgagaacgactactgtaagctctgcgatgcctccttcagttctccggcc
gtggcccaggctcactatcaagggaagaatcatgccaagaggctgcgactggcagaagcc
cagagtcactcattctcggaatcctcagaggtgggtccacggcggacccggaaagaaggg
aacgactttaagatgatgcctaataggagaaatatgtacacagtacagaacaattcaggt
ccttacttcaatcctcgttctcggcagagaatcccgcgagatctagccatgtgtgttact
ccaagtggccagttttactgctcaatgtgcaacgttggggctggcgaggagatggaattc
cggcagcatttggagagcaagcagcataaaagcaaggtgtctgaacagcggtacaggaac
gagatggagaatctgggatatgtatag

DBGET integrated database retrieval system