KEGG   Oryctolagus cuniculus (rabbit): 100359019Help
Entry
100359019         CDS       T03373                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00240  Pyrimidine metabolism
ocu00983  Drug metabolism - other enzymes
ocu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100359019 (TK1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100359019 (TK1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     100359019 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2
Motif
Other DBs
NCBI-GeneID: 100359019
NCBI-ProteinID: XP_008251367
Ensembl: ENSOCUG00000010046
UniProt: G1SYF7
LinkDB All DBs
Position
Un
AA seq 234 aa AA seqDB search
MSCINLPTVLPSSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDVR
YSHSFCTHDRNTMDALPACLLRDVAQEALAVAVIGIDEGQFFPDIVEFCEAMANSGKTVI
VAALDGTFQRKAFGSILNLVPLAESVVKLTAVCMECFREAAYTKRLGSEKEVEVIGGADK
YHSVCRLCYFKKSTGPPAGPDKENCPALAKPAEATAARKLFAPQQVLQCSLAAN
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcatcaacttgcccaccgtgctgcccagctcccccagcaagacccggggacag
atccaggtgatcctcgggcccatgttctcagggaaaagcaccgagctcatgagacgggtc
cgccgcttccagatcgctcagtacaagtgcctggtcatcaagtacgccaaggacgtccgc
tacagccacagcttctgcacgcatgaccggaacaccatggacgcgctgccggcctgcctg
ctgcgggacgtggctcaggaggccctggccgtggccgtcataggcatcgacgaagggcag
tttttccccgacatcgtggagttctgcgaggccatggccaactccgggaagacggtgatt
gtggctgccctggatggaaccttccagaggaaggctttcggctccatcctgaacctggtg
cccctggccgagagcgtggtgaagctgacagccgtgtgcatggagtgcttccgggaagcc
gcctacaccaagaggctgggctccgagaaagaggtggaggtgatcggtggggcggacaag
taccactccgtgtgccgcctgtgctacttcaagaagtccacgggcccgcctgcagggccg
gacaaggagaactgcccggcgctggccaagccggccgaggccacggccgccaggaagctc
ttcgccccccagcaggtcctgcagtgtagcctcgcggccaactga

DBGET integrated database retrieval system