KEGG   Oryctolagus cuniculus (rabbit): 100359215
Entry
100359215         CDS       T03373                                 

Gene name
REV3L
Definition
(RefSeq) REV3 like, DNA directed polymerase zeta catalytic subunit
  KO
K02350  DNA polymerase zeta [EC:2.7.7.7]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100359215 (REV3L)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100359215 (REV3L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100359215 (REV3L)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100359215 (REV3L)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   B-family DNA polymerases
    100359215 (REV3L)
SSDB
Motif
Pfam: DUF4683 DNA_pol_B DNA_pol_B_exo1 zf-C4pol
Other DBs
NCBI-GeneID: 100359215
NCBI-ProteinID: XP_002714966
Ensembl: ENSOCUG00000017034
UniProt: G1TCX3
LinkDB
Position
12
AA seq 3128 aa
MFSVRIVTADYYMASPLQGLDICQSPLTQLPVKKVPVVRVFGATPAGQKTCLHLHGIFPY
LYVPYDGYGQQPESYLSQMAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKER
HFMKIYLYNPAMVKRICELLQSGAIMNKFYQPHEAHIPYLLQLFIDYNLYGMNLINLAAV
KFRKSRRKSDTLHASGSCRNRLLGNSLPGTLFRWEEDEIPSSLILEGVEPQSTCELEVDA
VAADILNRLDIEAQIGGNPGLQAIWEDEKQRRRNRNETSQISQPESQDCRFVPATEGEKK
FQKRLQEILKQNDFSVTLSGSVDYSDGSQEFSAELTLHSEILSPEMLHCTPANMVEVHKD
VESSKGHTRHEVEEAVINEEAILNLMEHSQTFQPLTQRLSESPSFMGSSPDESLVHLLAG
LESDGYQVERNRMSSSCCSFGNTKNLQNSDDEENEPQIEKEEMELSLVMSQRWDCNIEEH
CAKKRSLCRNNHRSSTEEDDSSSEEEMEWSDNSLLLASLSIPQLDGTADENSDNPLNNEN
SRTHSSVIATSKLSIKPSIFHKDAATLEPPSSAKITFQCKHTSALSSHVLNKEDLIEDLS
QPNNTEKGLDSSVTFTNESTYSMKYPGSLSSTVHSENSHKESNKKDVLPVSSCESSIFDY
EEDIPSVTRQVPSRKYTNIRKIEKDAPFIHMNRHTNENSLGKNSFNFSDLNHSKNKLSSE
GNEKGNSTALNSLFPSSLTENCELLSCSGENKTMVHSLDSIADESGLNKLKIRYEEFQEH
KTEKPTLSQQAAHYMFFPSVVLSNCLTRPQKLSPVTYKLQPGNKPSRLKLNKKKLASHQE
NSTKGSGTGSTKDNCIQNSIQNNPYNNNPEKDNILATDFIKATRGAFENKIPTDGFIDCH
FGDGNLETEQSFGLYGNKYTLRAKRKVNYETEDSESSFVTHNSKISLPHPMEIGESLDGT
LKSRKRRKLSKKLPPVIIKYIIINRFRGRKNMLVKLGKVDSKEKQVILTEEKMELYKKLA
PLKDFWPKVPDSPATKYPIYPLTPKKSHRRKSKHKSAKKKTGKQQRTNSENIKRTLSFRK
KRSHAILSPPSPSYHAETEDCDLNYSDVMSKLGFLSERSTSPINSSPPRCWSPTDPRAEE
IMAAAEKEATLFKGPNAYNSKTVNSRIGKNSRARAQAKKSKAKLVNPSIVTKKRNKRNQT
NKLVDNGKKKPRARQKQKTNEKGTSKKHITLKDEKIKSQSGAEVKFVLKHQNVAELTNSP
GGSQLLFKQKDVSLTGSVIEHPLSVPLPTGINAQQKLSGCFSSFLESKKSVDMQTFPSSR
DDLHSSVVCSSVGSGISKINAQRSHNQSAMFSLKESTLIQKNIFDLSKHLSQVAQNTQIS
SGIMSPKTEENASIQKNYLSSVGKLNENRSSLESKLDQGCSSNFSHCKDSQPQIVCMAEQ
SKHSESCTVGNATSEESQMPNNCFVTSLRSPIRQIAWEQKQRGFILDMTNFKPEIVKQRS
FSEAISQTKALSQCKNQNVSTPSAFGEGQSGLAVLKELLQKRQQKAQNANIMQDPLSNKH
QPNKNISSSFEHNKANKQTRSVTSPRKPRTPRSTKPKEKNSKLLKVDSLNLQNSSQLDNS
LSDDSPVFFSDPGFESCYSLEDSLSPEHSYNFDINTIGQAGFCSFYSGSQFVPADQNLPQ
KFLSDAVQDLFPGQTIEKNEFLSHDNQKCDENKHHSSDSASWIRSGTLSPELFEKSSIDS
NENLRHSQWKNNFHPLTARSNSIIDSFCVQQAEDCLNEKSRLNRSSVSKEVFLNLPQPSN
SDWIQGHTRKEMGQSIDSVNTSFTTILSSPDGELVDAASEDLELYVSRNNMLTPTPDSSP
RSTSSPLQSKNGSFTPRTAHILKPLMSPPSREEIVATLLDHDLSETVYQEPFCSNPSDVP
EKPREIGGRVLMVETRLPNDLAEFEGDFSLEGLRLWKTAFSAMTQNPRPASPLRNGQPVV
NKGSSNSHKMVEDKKIVIMPCKCAPSRHLVQAWLQSKEECERSKKLPKTEPTGVTKSAEN
FSSSVNPDDTPVVPPKMDVNPHTLATTAHTKENIDNSQISSQVSTTGCSQTASESQMLPL
VASEKDEDDDDNHYSSPESPVIPPWQHAVSPDSRMLNGDDRTSSPVEELRSLAVENFLKP
IKDDIQKSPCSEPHEPLAISPINARTRTGKCESLCLHSTPVIPRKLLERLPDTTGLSPLS
TEPKTQKLSSKKGSNTDSLRRVLLTTQAKNQFATVNTPKKETSQIDGPSLNNTYGFKVSL
QNLQEAKALHEIQNLTLISVELHARTRRDLEPDPEFDPICALFYCISSDTPLPDTENTEL
TGVIVIDKDKTAFGQDIRYQTPLLIRSGITGLEVTYAADEKALFQEIANVIKRYDPDILL
GYEIQMHSWGYLLQRAAALSVDLCQMISRVPDDKIENRFAAERDEYGSDTMSEINIVGRI
TLNLWRIMRNEVALTNYTFENVSFHILHQRFPLFTFRMLSDWFDNKTDLYRWKMVDHYVS
RVRGNLQMLEQLDVIGKTSEMARLFGIQFLHVLTRGSQYRVESMMLRIAKPMNYIPVTPS
VQQRSQMRAPQCIPLIMEPESRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGHVENLGK
YDEFKFGCTSLRIPPDLLYQIRHDITVSPNGVAFVKPSVRKGVLPRMLEEILKTRLMVKQ
SMKAYKQDRALSRMLNARQLGLKLIANVTYGYTSANFSGRMPCIEVGDSIVHKARETLER
AIKLVNDTKKWGARVVYGDTDSMFVLLKGATKEQSFKIGQEIAEAVTSTNPKPVKLKFEK
VYLPCVLQTKKRYVGYMYETLDQKDPVFDAKGIETVRRDSCPAVSKILERSLKLLFETRD
ISLIKQYVQRQCMKLLEGKASIQDFIFAKEYRGSFSYRPGACVPALELTRKMLTYDRRSE
PRVGERVPYVIIYGSPGVPLIQLVRRPVEVLQDPTLRLNATYYITKQILPPLARIFSLIG
IDVFSWYHELPRIHKASSSSRSELEGRKGTISQYFTTLHCPVCDELTQHGICSKCRSQPQ
HVAIILNQEIRELERKQEQLTKICKNCTGCFDRHIPCVSLNCPVLFKLSRVNRELSKAPY
LRQLLDQF
NT seq 9387 nt   +upstreamnt  +downstreamnt
atgttttcagtgaggatagtgactgccgactactacatggccagcccgctgcaggggctg
gatatctgccaatcccccctcacccagctccctgtcaagaaggtgccggtggtgcgagtc
ttcggagcgaccccggcaggtcagaagacatgtcttcacctacatggcatctttccttac
ctctatgtgccatacgatggttatggacagcagccagaaagctatctttctcagatggca
ttcagtatcgacagagcacttaatgtggctttaggcaatccatcttctactgctcagcat
gtgttcaaagtatcattagtatcaggaatgcctttttatggttatcatgagaaggaaaga
cactttatgaagatctatctttacaatcctgcaatggtgaaaaggatatgtgaacttttg
caaagtggagccataatgaataaattttaccagcctcatgaagcacatattccctacctc
ctacagctcttcattgactacaatctttatggaatgaatttaataaatctggctgctgtc
aagttccgaaaatcaagaaggaaaagtgatacattgcatgcatctggatcatgcaggaat
cggttattgggaaattcgcttcctggtactttatttcggtgggaagaagatgaaatacca
agctctttaatactggaaggtgttgaaccacagagtacatgtgaattagaagtggatgct
gtagctgctgacatcttaaatcggctggacattgaagctcagattggtggaaaccctggt
ttacaggccatatgggaggatgaaaagcagcggcgtagaaacagaaatgaaacttctcaa
attagccaacctgaatcacaagattgcaggtttgtgccagcaacagaaggtgaaaaaaaa
tttcagaagagacttcaggaaattctcaaacagaatgatttctctgtaacattatcagga
tctgtggactacagtgatggatcccaggaattctctgctgagttaacattgcactctgag
attctgtctcctgaaatgcttcattgtacgccagccaatatggtagaagttcataaagat
gtggagtcgagcaaaggtcacactagacatgaagtggaggaagctgttattaatgaagaa
gcaattttgaaccttatggaacatagtcagacttttcagcctttgacccaaagactgagt
gagtcaccaagcttcatgggcagtagtcctgatgaatcgttggtacatcttcttgctggt
ttggaaagtgatggctatcaggtagaaagaaatagaatgtcatcttcatgttgctccttt
ggaaacactaaaaatctccaaaatagtgatgatgaagaaaatgaaccacagattgaaaaa
gaggaaatggagcttagtttggtgatgtcccagagatgggactgcaatattgaagaacat
tgtgccaaaaaaagatcactgtgcagaaataaccacagaagttcaactgaagaggatgat
tcctcttctgaagaagaaatggaatggagtgataacagtttgcttctagccagtctttct
atacctcagttagatggaactgcagatgaaaatagtgacaatccattgaacaatgaaaat
tctagaacccattcttctgtgattgcaacaagcaagctatcaataaaaccctccatcttt
cacaaagatgctgctacattagaacccccatcttctgctaagattacctttcagtgtaaa
cacacaagtgccctttcttcccatgttttgaacaaggaagatttaattgaagacctttca
cagccaaacaacacagaaaaaggtctagatagttcagtcacttttacaaatgaaagcact
tattctatgaaatatcctggatctttaagcagtactgtccattcagaaaattctcataaa
gagagtaataaaaaagatgtgctccccgtatcctcctgtgaaagtagtatttttgattat
gaagaagatattccatctgttacaagacaagtaccaagtagaaagtatacaaacattaga
aagattgaaaaggatgcaccttttatacatatgaaccgtcacactaatgagaactcattg
ggcaaaaactctttcaacttttctgacttaaatcattcaaaaaataaattatcttctgaa
ggaaatgaaaagggaaacagcacagctctgaatagtttattcccttcatcattaactgaa
aattgtgaattgctttcatgctcaggggagaataaaactatggtacattctcttgatagc
attgctgatgaaagtggactaaataaactcaaaatcagatatgaagaatttcaagaacat
aaaacagaaaagccaaccctcagccagcaagcagcacactatatgtttttccctagtgtt
gttctttctaattgtctcactaggccacagaaactgtctcctgtcacttacaaactacaa
cctggaaataaaccatctcggttaaaattgaataaaaagaaacttgcaagtcatcaggag
aattctaccaaaggtagtgggactggatccacaaaagataattgtatacaaaatagtata
caaaataatccttataacaataatcctgagaaggataatatattggccactgatttcatt
aaagccactcgtggagcttttgaaaataaaatacctacagatggttttatagactgtcac
tttggagacgggaacttggaaactgagcagtcctttggactatatggaaataaatataca
cttagagccaaacgcaaagtaaattatgagactgaagatagtgagtcaagttttgtaaca
cacaactcaaaaattagcctacctcatcccatggaaataggagaaagtttagatggaact
ctgaaatctcgaaaacgaagaaaactgtctaaaaagcttccccctgtcatcataaagtat
attatcattaatagatttagagggagaaaaaatatgcttgtaaagctaggaaaagtagac
tctaaagaaaaacaagtcatattaacagaagaaaaaatggaactatataaaaagcttgca
cctttgaaggatttttggccaaaagttcctgactcccctgcaaccaaataccccatttac
ccactaacaccaaagaaaagtcacagaagaaagtcaaaacataagtctgctaagaaaaaa
actggtaagcagcaaagaacaaatagtgaaaatattaaaagaactttgtctttcaggaaa
aaacggtcgcatgctattctttctcctccctcaccatcttaccatgctgaaaccgaagac
tgtgacttgaattatagtgatgttatgtctaaactaggttttctttctgagagaagcaca
agtcccataaattcttctccacctcgctgctggtctcccactgacccaagagctgaagaa
atcatggctgctgcagaaaaagaagcaacactttttaagggtcctaatgcatacaatagt
aagactgttaattctcgtataggaaaaaatagtcgggcaagagcgcaagctaagaaatca
aaggcaaagcttgttaatccctctatagttactaagaaaaggaacaaacgaaatcagaca
aacaaactggtagataatggaaaaaagaaaccaagagcaagacagaaacaaaagacaaat
gaaaaaggtacatcaaaaaagcatataacacttaaggatgaaaaaataaaatctcagtct
ggtgctgaagttaagtttgtgctgaaacaccagaatgtggctgagctcacgaacagtcct
ggaggctctcaactactttttaaacagaaagatgtgtcactcacaggctctgttatagag
catcctctttctgttcctctaccaactggaattaatgcacaacagaagttatctggctgc
ttttcttcttttttagaaagcaaaaaatctgtggatatgcaaacattccccagttctcga
gatgatctgcattcatcagttgtatgtagttctgtaggatctggaatctcaaaaattaat
gctcaaaggtctcataatcagagtgctatgttttctctgaaagaatcaacgttgattcaa
aaaaatatattcgacctttccaaacatttatctcaggtagcacagaatacacagatatct
tcaggtataatgtctccaaagacagaagagaatgcaagtatacaaaaaaactatttgtca
tctgttggaaagttaaatgaaaatcgcagttccctagaatcaaagctggatcagggatgt
tcttctaatttttcacattgcaaagacagtcagccgcagatcgtatgcatggcagaacaa
tccaagcacagtgaatcgtgtactgtaggaaatgcaacttcagaggaaagccaaatgcct
aataattgctttgtaacttccttgagaagtcccatcagacaaatagcatgggagcagaaa
caaaggggttttattttagatatgacaaattttaagcctgaaatagtaaaacaaaggtca
ttttcagaagcaatttcacaaaccaaagcactttctcagtgtaaaaatcaaaatgtgtca
acaccttcagcatttggcgaaggacagtctggactagcagttctaaaagaactgttacaa
aaaaggcagcagaaagcacaaaatgcaaatattatgcaagatccattgtctaacaaacat
caaccaaacaaaaatatttctagttcctttgaacacaataaagcaaataagcagacacga
tcagtaacatctccaagaaaacctcgaactcccagaagtacaaaacctaaagagaagaat
tccaaacttctaaaagtagactctttaaatttacaaaactctagccagttggataattcc
ctctcagatgatagtcctgtctttttttcagatccgggttttgagagttgttattcactt
gaagatagcttgtctcctgaacatagttataattttgatattaatacaattggtcaggca
gggttttgtagcttttattctggaagtcagtttgttccagctgatcagaatttgcctcag
aagtttttaagtgatgctgttcaggatctttttccaggacaaactatagaaaaaaatgag
tttttaagtcatgataaccaaaagtgtgatgaaaacaagcatcattcttcagattcagcc
tcatggattagatctggtactttaagtcctgagcttttcgaaaagtcatccatagatagc
aatgagaatcttcgccacagccagtggaaaaataactttcatcccctaacagctcggtcc
aattccataatagattctttctgtgtccagcaagcagaggactgtctaaatgaaaaatcc
agattgaataggagttcggtaagcaaagaagtgtttcttaacctcccacagccaagcaat
tcagactggattcaaggtcacaccagaaaagaaatgggacagtcaattgactcagttaat
acctcttttactacaatactctcctctcccgatggtgaacttgtagatgcagcttctgaa
gatttagaattgtatgtttcaagaaacaatatgttgacaccaactcctgatagttcacca
aggtctaccagctctcccttacaatctaaaaatggcagtttcactcctcgaactgctcac
attctgaaaccacttatgtccccaccaagtagggaagaaattgtggcaacattgttggat
catgacctttcagaaactgtttaccaggaaccattctgcagtaatccttctgatgtgcca
gaaaagcccagggagatcgggggacgggtcctcatggtcgaaactagacttccaaatgat
ctggctgagtttgagggagacttttctttggaaggacttcgtctgtggaaaacagcattc
tcagcaatgactcagaatccaagaccagcatcaccccttcgtaatggccaaccggttgtc
aataaagggtcaagcaatagccataaaatggttgaagataaaaaaattgtgattatgcct
tgcaaatgtgccccaagtcgacatctagttcaagcatggcttcaatccaaagaagaatgt
gaacgttccaagaaactgcctaaaactgagccaactggagttacaaaatctgctgagaac
tttagctcttcagttaacccagatgacacacctgtagtgcctccaaagatggatgtaaat
ccacatacacttgccactacagcacataccaaggaaaatattgataattctcagatttct
tcacaagtgtcaaccacaggatgcagtcaaactgcaagtgaaagtcagatgctgccacta
gttgcctctgagaaagatgaagatgatgatgataatcactatagctcccctgagtctcca
gtaattcccccttggcaacatgcagtatccccagattccagaatgttaaatggagatgat
agaacctcatcgccagtagaggagctccgttctctggctgtggagaacttcttaaagcca
ataaaagatgatatacagaaaagcccctgcagtgagcctcacgagcctctagcaatatct
ccaattaatgctaggacacgaactgggaaatgtgaatcattatgccttcatagtacacca
gtcataccaagaaaacttctggaaaggcttcctgacacaactggtcttagccctttatca
acagaaccaaaaacccagaagttgagtagtaagaaaggaagtaatactgacagtcttaga
agagtactcttaacaacacaagcaaagaaccaatttgcaacagtaaataccccaaagaaa
gaaacttctcagattgatggaccatctttaaacaatacttacggtttcaaagtcagccta
caaaacttacaagaggcaaaagctttacatgagatacagaatcttactctaatcagtgta
gaattacatgctcgaactagaagagacttagaaccagatcctgaatttgacccaatctgt
gctctgttctactgcatctcatctgatacaccactaccagatacagaaaatacagaactc
acgggtgtcatagtgattgataaagacaaaacagccttcggacaagatatcagatatcag
acaccattacttatcagatctggaattacaggactagaagttacctatgctgctgatgag
aaggcactgtttcaagaaattgcaaatgtaataaagaggtatgatcctgatattctgtta
ggatatgaaattcaaatgcattcctggggctacctcttacaaagagctgctgctttaagt
gttgacttatgtcagatgatctctcgtgtgccagatgacaagattgagaacagatttgca
gctgaaagagatgagtatggatcagatacaatgagtgagataaatattgttggccgaatt
acactaaatctatggagaattatgagaaatgaggtggccctaactaactacacctttgaa
aatgtcagctttcacattcttcatcagcgtttccctctctttacctttcgaatgttgtca
gattggtttgataacaagacagacctgtacagatggaaaatggttgatcattatgttagc
cgtgtccgtggaaatctccaaatgttagaacagctagatgtgattgggaagaccagtgaa
atggctagactttttggcattcagtttttacatgtactgacaagaggttcacagtaccgt
gtggaatcaatgatgttgcgtattgccaaaccaatgaattatattccggtgacacccagt
gttcagcagagatctcaaatgagagccccacagtgtattcctctaattatggaacctgag
tcccgcttctatagcaattctgtacttgttctagatttccagtcattatatccttctatt
gtgattgcatacaactactgtttttctacctgccttggccacgtggagaacttaggaaag
tatgatgagttcaaatttggctgtacctctctaagaatacctccagacttactttaccaa
attaggcatgatatcacagtgtcacccaatggagtagcttttgtcaagccttcagtaaga
aagggcgtgctgccaagaatgcttgaagaaattttgaagactaggctcatggtgaagcaa
tcaatgaaggcttacaaacaagacagagccctatcacgaatgcttaatgcacgtcagcta
ggacttaagctgatagcaaatgtcacatacggctatacatctgcaaacttttctgggaga
atgccatgcattgaggttggtgatagtatcgtccacaaagccagagagactttggaacga
gctattaaactggtgaatgataccaagaaatggggtgctagggttgtgtatggagatacc
gacagtatgtttgtgctactgaaaggagccactaaggagcagtcttttaagattggtcaa
gaaattgctgaagctgtaacttctaccaaccctaaaccagtgaagttgaagttcgaaaag
gtatatttgccctgtgttttacaaacaaaaaagaggtatgtgggttacatgtatgaaaca
ctggatcaaaaggacccagtatttgatgcaaaaggaatagaaactgttagaagagattcc
tgccccgctgtttctaagatacttgagcgttctctgaagctgctgtttgaaacaagagat
attagtctaattaaacagtatgttcagcgacagtgtatgaagcttctggaaggaaaggcc
agcatacaagattttatctttgccaaggaatacagaggaagtttttcttacagacctgga
gcttgtgtgccagcccttgaacttacaagaaaaatgcttacttacgatcggcgctctgag
cctcgagttggggagcgagtgccctatgtcatcatttacgggagtcctggagtgccactt
atccagctggtaaggcggccagtggaagtcctgcaagacccgactctgagactgaatgcc
acttactatatcaccaagcaaattcttccacccttggcaagaatcttctcacttattggt
atcgatgtcttcagttggtatcatgaattaccaaggatccacaaagcctccagctcctct
cgaagtgaacttgaagggcggaaaggcactatttcacaatatttcaccactttacactgt
cctgtgtgcgatgagctgactcagcatggcatctgtagtaaatgtcgaagccaacctcag
catgttgccatcatcctcaaccaagaaatcagagagttggaacgcaaacaggagcaactt
acaaagatatgcaagaactgtactggttgctttgaccgacatatcccatgtgtttctctg
aactgcccggtacttttcaaactctcccgagtaaatagagaattatcaaaggcaccatat
ctccggcagttactagaccagttttaa

DBGET integrated database retrieval system