KEGG   Oryctolagus cuniculus (rabbit): 100359253Help
Entry
100359253         CDS       T03373                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00052  Galactose metabolism
ocu00500  Starch and sucrose metabolism
ocu01100  Metabolic pathways
ocu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100359253
   00500 Starch and sucrose metabolism
    100359253
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100359253
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100359253
    3.2.1.20  alpha-glucosidase
     100359253
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100359253
NCBI-ProteinID: XP_017193324
LinkDB All DBs
Position
Un
AA seq 2397 aa AA seqDB search
MARKLSLLEALLIAFDVIVVIADVLLLILLLENPSDSSFTPECPEISQSERIDCAPGRVV
TEEVCRQQLKCCWSPVADAAVPVCFFPRNWGYEVSDGIRDTSTGFTAQLTRVPSPSLFGN
DVLNALFTAENQTPSRFRFKITDSNNMRYEVPHENIKTLNGTADPSSLSYRVEVTDKPFS
LKILRTSNQRVLLDTSIGPLQFAHQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWKTWPI
FTRDTTPTAGMINLYGAHTFFLCLEDTSGFSFGVFLMNSNAMEITLQPAPAVTYRTIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFLPSYWSLGFQLSRRDYGGIHGLREVVDRNRRAGI
PYDVQYSDIDYMDGKKDFTIDEGAYPGLSDFAKELHDNGQKYMIIMNPGIFRSPEYTAYN
NGSLKRVWILDNHGFAVGEGYPGPAVFPDYSNPEGTQWWTEQLTEFHNQLEFDGVWIEMD
EVSSLLQGSGHECESNRLNSPPFTPRVLGGRLSERTLCMDTEFHSGLHYDVHSLYGYSMA
RATDSAMEAIFLNNRSFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGI
PMVGANICGYFGNVSEELCRRWMQLGAFYPLSRNHNGPGFMDQDPAAFGDDSLLLNSSRH
YLNIRYTLLPYLYTLFYRAHTLGETVARPLVHEFYQDPATWDVHEQFLWGPGLLITPVLY
EGVDQVKAYIPDDIWYDYETGVAMQWRKQLVDMLLPGDSMGLHLRGGYIFPTQQPDVNTE
SSRKNPLGLIIALDYKREAKGELYWDDGESKDAVTERKYILYDFSVTSNRLQAKILNNNY
EDPDSLMFTDIKILGMDKEPTNFSVIFNNAVTSISSVTYSASTKVVTITNLQGLVLGQEF
SIEWALPVNDLEKFNCYPEDPAVSEENCRLRGCLWEHTTTPGVPTCFYDTTPNYAASNVQ
YLSTGITTDLTLLEAPELARAVELALPLPLGAVHPQPEAATTADPASLSAKISNLVLTVT
YHTEYMLQVKIYDPTNKRYEVPVPLNTPPSPVGSPENRLYDVTIQTNPFGIQIRRKRSST
VIWDSQLPGFTFNDQFLSISTRLPSQYIYGFGETEHTAFRRNMSWHTWGMFARDEPPAYK
KNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDITLQPTPALTYRTTGGTLDFYIVLGPTPE
LVTQQYTELIGRPAMTPYWALGFQLSRYGYQNVAEIASLYDAMVAAQIPYDVQHVDMDYM
DRKLDFTLSPSFQNLSLLMEQMKEDGMRFILTLDPAISGNETQYLTFTRGQENDVFITWP
DTSDIVWGKVWPELPNVNVNGSLDNEAQVRIQLAHVAFPDFLRNSTAAWWKKEIQELYTN
PQEPEKSLKFDGLRIDMNEPSNFVDGSVNGCRNDILNNPPYVPYLESRGTGLSSKTLCME
SEQILPDGSRVRHYDVHSLYGWSQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLG
ENTAAWDQLGKSIIGMMEFSLFGIPYTGADICGFFGDAEYEMCIRWMQLGAFYPFSRNHN
TIGTRRQDPVAWNSTFEMASQKALQIRYSLLPYLYTLMYKAHVEGSTVIRPLLHEFTNDS
TTWDIDQQFMWGPAILISPVLESNTFAIRAYFPQALWYDYSTESGNNSTGEWRILQAPLD
HINLHVRGGYILPWQEPAVNTHSSRQKFMGLIVALDDNGEAEGELFWDDGQSIDTYENGN
YFLANFTAAQNILQIKTVYNRFLSDSNPLNVGYIRIWGMNSGHVNQVNFTYNNELFMEMN
FRSDPYNQTLTIQWTDKNISLEKLTEVIWTYGDPIHPTSAMTSTFPISSHPSPVTTKTTS
FETITSSTTANTAVSTTDATTGTGVTNAPTLYPTSTSSTVPSITTPFPTSTIDATTSGLD
KTTSFPISTFDATSSTSVPDTTTLYPLLTTTDINSATVPTKTTPLTIITTNPTTVTRDPG
TNTPSPTNSATDSTSATISIVTPFPTNTIEVTTSATSAGTSVPTASNTTIVSSNTILLML
GPFWFSCYNYTFAYDSSITTPSDLSTYGTSPNATLPITATPSTMTGAHATSPRFSIRTIS
FSXSTDAVNGTIVMITTSPLSIDVTSTTTDASITNTXLPIVSGNDCTSNIISIVTTPSPT
NTRAASTDPLSGVTNPFSTSTSAASIGNIDPVVTTSSIDTNNTVSDMTTHYQTPPTTPTP
ILTSILFSTAPILSTFPTTSTFATYIITNFTTSTNENSTNFNTPDTKTTMIIDAVVAATS
NKYITMSPDTAVTSTAKFTTHTLPNPRSYTWFQQKFTNSITAFDRVLINPYPSGTTAIPT
TNTISSKGHRVNITDMGDSSSIIGNTVHTYIPNITIASDKISATVLDKETHHLIPLS
NT seq 7194 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggaagctcagtttgttggaagcccttttgattgccttcgatgtaattgtagtc
atcgcagatgtcctcttgctgattctcctactggaaaacccttcagattcttcatttact
ccggagtgccccgagatctcccaatcagaaaggatagactgtgcacctggccgggtggtg
acagaggaagtctgcagacagcagctgaagtgctgctggagccctgtggccgatgcagct
gtccccgtgtgcttcttccccaggaactggggctacgaagtcagcgacggcatcagagac
acaagcacaggtttcactgctcagctgacaagggtgccatccccatctctgtttggaaat
gatgtcctcaacgctctcttcacggctgaaaatcagacacccagtcgttttcgctttaag
atcaccgattccaataacatgcgctacgaagtccctcatgaaaacattaagacgcttaat
gggactgctgatccttccagtctgagctatcgtgtggaggtcacggataaacccttcagc
ctcaaaatactgaggacaagcaaccagcgagtcttgttggacacgagcattgggcccctc
cagtttgcccaccagtacctccagctgtcgttccgactgcctagcgccaacgtgtatggg
ctaggggagcatgtgcaccagcagtaccgccacaacatgacctggaagacctggcccatc
ttcacccgggacaccacgcccacggcgggcatgattaacttgtatggagctcataccttc
ttcttgtgcctagaggacaccagtggcttctcgtttggagtttttctgatgaacagcaat
gccatggagatcacccttcagcctgctcctgccgtcacttaccgaacaattgggggcatt
ctcgacttctatgtgttcctgggaaacactccagaacaagtggttcaggagtacttggag
ttggttgggcggccattcttgccttcctactggagtcttgggttccagcttagtcgaagg
gattacggaggcatccatggattgagagaggtggtagaccggaatcgcagagctgggatt
ccctatgatgtccaatattctgacatagactacatggatggaaagaaggatttcactatt
gatgaaggagcttaccctggtctctcagattttgccaaggagttacatgacaatggacag
aagtacatgattattatgaatcctggcatcttcaggagccctgagtacacagcctataac
aatggaagcctaaagagagtatggatcttggataaccatggctttgctgttggggagggg
taccctggaccagcagtctttcctgactacagcaatcccgagggcactcagtggtggacg
gagcagctcactgagtttcataaccagctagagtttgatggagtgtggattgaaatggat
gaagtgtccagccttctccaaggttctggtcatgagtgtgaatcaaacaggttgaattct
ccacctttcactcccagagtcctgggcggtcggctctctgaaaggaccctctgcatggac
acagagtttcactccggtcttcactatgacgtccacagcttgtatggctactccatggcc
agagccacagactcggccatggaggctatctttctaaataataggagcttcatattatcc
cgctcaacttttgctggatctggaaaatttgctgctcattggcttggggataatgcggct
acatgggacgacctccggtggtccatccccagtatcctggagttcaacctgtttggtatc
cccatggtaggtgccaacatctgtggttattttggaaatgtctcggaggagctctgtaga
agatggatgcagctgggagcattttatccactctcgaggaatcataatgggcctgggttc
atggaccaggaccctgctgcctttggtgatgactccttgctgttgaattccagcagacat
tacctgaacattcgctacaccctgctgccctatctctacaccctcttctaccgtgctcac
acgctgggggagacggtggcaaggcccctggtacatgagttctaccaggacccagccaca
tgggatgtccatgagcagttcttatgggggcctgggctcctcatcacacctgtcttatat
gaaggtgtggaccaagtgaaagcgtacataccagatgacatctggtacgattatgagaca
ggagtggccatgcaatggaggaaacagttggtggatatgctactcccaggtgatagcatg
ggacttcaccttcgagggggctacatatttcccacccagcagccagacgtaaatacagag
tccagccggaagaatccactggggctcatcatcgccttggactacaagcgagaggcaaag
ggggagctgtactgggatgatggtgaatctaaagatgctgtaactgaaaggaaatacatt
ctgtatgacttctctgttacctctaaccgtctacaggccaagattctaaataataattac
gaggaccctgacagcctcatgtttacagatatcaaaatcttgggaatggacaaggagcca
actaattttagtgtcatatttaataatgctgtcacctccatttcaagtgtcacctacagt
gcttcaacaaaggtggtgaccatcactaatctccagggcctggtactgggacaggaattc
tccatcgagtgggctcttccagtcaatgatctagaaaagttcaactgctaccctgaggat
cctgctgtctccgaggagaattgcaggttgcgggggtgtctttgggagcacacaactact
cctggtgtgcccacctgcttctatgacaccacccctaactacgccgccagtaacgttcag
tacctgtccacgggcatcactacagaccttaccctcttggaggccccagaattggctcga
gcggtggagctggctctgccgttgccactgggagctgtgcatccccagcctgaagcagct
accaccgcggatcctgcttctctctctgcaaagatcagcaacctcgtgctgactgtgacc
taccacacagaatacatgctgcaggtcaagatctacgatcccactaataaaagatacgaa
gtaccagtacccctaaatacccctccctcgccggttggctcccctgaaaaccgcctgtat
gatgtcacgattcagaccaatccttttggaattcagattcgacgcaaaagatccagcact
gtaatttgggactctcagctgcccggcttcaccttcaacgaccagttcctctccatttcc
actcgcctcccctcacagtacatctatggctttggggagaccgagcacacagctttcaga
agaaacatgagctggcatacgtggggaatgtttgctcgcgatgagcccccggcgtacaag
aagaattcctatggtgtgcacccctactacatgggcctggaggaggatggcagtgcccac
ggagtgctcctgctgaacagcaacgccatggatataacactgcagcccactcctgccctg
acgtaccgcaccacaggagggactttggacttctatatcgttttagggccaacccctgaa
cttgtaactcagcaatacactgagttgatcggtcggccagcaatgactccatactgggcc
ttgggattccagctgagtcgctacggataccagaatgttgctgaaatcgccagtttgtat
gatgcaatggtggcagcccaaattccttatgacgtccaacatgtagacatggattacatg
gaccggaaactggacttcaccctcagccccagctttcaaaacctgagtctgctgatggag
caaatgaaggaagatggcatgagattcatacttactctggacccagccatttctggtaat
gagacacagtacctcacgttcactagaggacaagaaaatgatgtgtttatcacatggcct
gacacgagtgacattgtctggggaaaggtttggccagagctgcccaatgtaaatgtgaat
ggatctcttgacaatgaagctcaggttagaatacaattggcccacgttgcttttcctgat
ttcctgagaaatagcacagctgcgtggtggaagaaagaaatacaagagctctacacaaac
cctcaggagccagagaagagcttgaaatttgatgggttgaggattgacatgaacgagcca
tcaaactttgtggatggatctgtcaatggctgccgaaatgatattcttaataatccaccc
tatgtgccatacctggagtccaggggcacgggcctgagcagcaagaccctgtgcatggag
agtgagcagatcctgccagacggctcccgagtgcggcactacgacgtgcacagcctgtac
gggtggtcccagaccagacccacctacgaagccgtgcaggaggtgacgggacagcgaggg
atcgtcatcacccgctccacgttcccctcttctggccgctggggtggacactggctgggg
gagaacacagcggcgtgggaccagctggggaagtctatcattggtatgatggagttcagt
ctctttggaataccttatacaggagcagacatctgtgggttctttggagatgctgaatat
gagatgtgcattcgctggatgcagctgggggccttttatccattttccaggaaccacaac
accatcgggacgaggagacaagatcctgtggcatggaactcaacctttgagatggcctca
caaaaagccctgcagatcagatactccttgctgccttatctctacacgctgatgtacaag
gctcacgtggagggcagcactgtcatccgacctcttctccacgagtttacaaacgacagc
acaacgtgggatatagaccaacagttcatgtggggccctgccatccttatcagccctgtg
ctggaaagtaacacttttgcgatccgtgcctatttccctcaagccctttggtatgactac
agcacggagtctggaaacaactcgacaggcgagtggagaatcctgcaggctccccttgac
cacatcaatcttcatgtcagaggaggctacatcctgccttggcaagaacctgcagttaac
actcactccagtcggcaaaaatttatgggattaattgttgcattggatgacaacggggaa
gctgagggtgagctgttctgggatgatggacaaagcatcgatacctatgaaaatggaaac
tatttcttggcaaacttcacagcagctcagaacatcttacaaatcaagaccgtatacaat
aggtttttgagtgactcaaatccacttaatgttggatatattagaatctggggtatgaac
tctggtcatgtaaatcaagtcaatttcacctataacaacgagctattcatggagatgaat
tttaggagtgacccttataatcagacactaacaattcaatggaccgacaagaatatcagc
ctggaaaagttaactgaggttatttggacttacggtgatcctatacatcctacttctgct
atgacaagtacctttccaataagttctcatccatctccagtgactacaaagactactagt
tttgagactatcactagttctactactgcaaatactgctgttagtactactgatgcaaca
actggtacaggagttactaatgcacctactctgtatcctacaagcaccagttctactgtt
cccagtataaccactcctttccccacaagtactatcgatgcaacaactagtggccttgat
aaaaccacttctttccccataagtacatttgatgctacaagtagtaccagtgttcctgac
acaaccacgctttacccacttttgactactactgatatcaatagtgcaactgttcccaca
aaaacaactcctttgaccataattactacaaatccaacaactgttacaagagatcctgga
acaaatactccttcacctacaaatagtgctacagacagcaccagcgctaccatttctatc
gttactcctttccccacaaatactattgaggttacaactagtgctacttctgctggtaca
tctgttcctactgcctccaatactactattgtaagtagtaataccatactactaatgtta
ggacctttctggttttcctgttataactacaccttcgcctatgattctagcattaccact
ccctctgatctgagtacttatggtactagccctaatgctactcttccaattacggctaca
ccttctacaatgactggtgctcatgctactagccctagattctctattaggactatttct
ttctcttaaagtactgatgctgtgaatggtactattgttatgataactacttctcctcta
agcattgatgttactagtactactactgatgcttctattacaaatacatgactccctata
gtgtctggtaatgattgcactagtaatattatttctatagtgacaactccttctcctact
aatactcgtgctgctagcactgatcctctttctggtgtgactaatcctttttctacaagt
acaagtgctgctagcattggcaatattgatcctgttgtgactacttcttctattgataca
aataatactgtgtctgacatgactactcattatcaaactcctcccaccactcctactcct
attcttacttctatcctcttttctactgccccaattttgagcacatttccaacaacaagt
acatttgctacttatataatcactaattttactacatctactaatgaaaatagcactaat
tttaacactccagatacaaaaactaccatgataatagatgctgtagttgctgctaccagt
aacaaatatattaccatgagtccagatacagcagttacttctacagccaaattcaccaca
catacacttcccaatccacgtagctacacatggtttcaacaaaaattcacaaattcaata
acagcttttgatagagtccttataaacccttacccttcaggtactacagctattcctacc
accaatactataagcagtaaaggacacagagtaaatattactgatatgggtgactctagc
agtattataggtaacactgtacacacttatattccaaatatcacaatagcttcagacaag
atatcagctactgttctagataaagaaactcaccatctgatacctctaagttaa

DBGET integrated database retrieval system