KEGG   Oryctolagus cuniculus (rabbit): 103345135
Entry
103345135         CDS       T03373                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103345135 (IL3RA)
   04151 PI3K-Akt signaling pathway
    103345135 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103345135 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103345135 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103345135 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103345135 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    103345135 (IL3RA)
   04090 CD molecules [BR:ocu04090]
    103345135 (IL3RA)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL3 receptor family
   103345135 (IL3RA)
CD molecules [BR:ocu04090]
 Proteins
  103345135 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind Tissue_fac EpoR_lig-bind
Other DBs
NCBI-GeneID: 103345135
NCBI-ProteinID: XP_008246682
Ensembl: ENSOCUG00000022761
UniProt: A0A5F9D323
LinkDB
Position
2
AA seq 394 aa
MLLSLLLPNTPGTCSPALTMTALWLTLLLMPTSHLLQIHPDMSPPITNLRMEAKPDRLTW
DLHGNATNIKCIKDSKQILKAEQDRYCEYHALSLCKVSNYTVRVGNPPFSTWILFPEPDG
DSEAAAKNLTCWVHDMTVLTCRWAVGRAAPRGVQYRLSWRVGSGKDLECPRYHVDERGVR
VGCRWDDVSRYQGGFLVQVHGASAGARIPCKEDMVDFFQQERLSPPNVTIRCNLTHAFLE
WKNVSHFNRRVRYQLSIQRGQGAPVEQIFRDNVNSLDLLHPGTFVVRIRAEAYLAGIRSD
WSAPQRFVCDSAGDTLSRVWWAALLIALAMLLALLFMFLLCRRFSVVQKILPPVPNVKDP
LWDLGQNYKLVVWDIGQPSPEDCPVAQVQVQETA
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgctgctgtcactgctgctgccaaacaccccaggtacctgctctcctgcgctcaccatg
acagccctgtggctgaccttgctcctcatgcccacctcccatctgcttcaaatccaccca
gacatgagtccacccatcacgaacctcaggatggaagcaaaacctgacaggctgacctgg
gacctccatggaaatgcaaccaatattaaatgcatcaaagactccaagcaaatcctgaag
gcggagcaggacaggtactgtgagtaccacgcactctccctgtgcaaagtcagcaattac
accgtgcgcgttggcaatccgcctttctccacgtggatcctgttccctgagccagacggc
gactctgaggccgcggccaagaacctgacttgctgggtgcacgacatgactgtgctcact
tgtcgctgggctgtgggcagggcggccccgcgcggtgtccagtaccggctctcctggaga
gtagggagcggcaaggaccttgagtgcccgcgctaccacgtagacgagcgcggcgtgcga
gtcggctgccgctgggatgatgtctccaggtaccagggcgggttcctggtgcaggtgcat
ggcgcaagcgcaggagcccgtatcccctgcaaggaagacatggtggatttcttccagcag
gagagattgagtccgccaaatgtcaccataaggtgcaatctcacccatgctttcctggag
tggaagaacgtgagccatttcaaccgcagagtccgttaccagctgagcatacagaggggc
caaggagctcctgtggagcaaattttccgagacaacgtgaattcgttggacctcctccat
ccagggactttcgtggtgagaatcagagcagaggcatacctcgcaggcatacgcagtgac
tggagcgcaccccagcgctttgtgtgcgactctgcaggggacaccttgagccgtgtctgg
tgggcagctctgctgattgccctggcgatgcttctggccctgctgttcatgttcctgctg
tgcagacggttctcggtggtgcagaaaatcctccctcctgtgcctaacgtgaaagacccc
ctgtgggacctcgggcagaactacaagctggtggtctgggacattggccaacccagccca
gaggactgtcctgtggcccaggtacaggtgcaggagacggcttga

DBGET integrated database retrieval system