KEGG   Oryctolagus cuniculus (rabbit): 103345957
Entry
103345957         CDS       T03373                                 

Definition
(RefSeq) ral guanine nucleotide dissociation stimulator-like
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103345957
   04015 Rap1 signaling pathway
    103345957
   04072 Phospholipase D signaling pathway
    103345957
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103345957
   05231 Choline metabolism in cancer
    103345957
  09162 Cancer: specific types
   05210 Colorectal cancer
    103345957
   05212 Pancreatic cancer
    103345957
SSDB
Motif
Pfam: RasGEF DUF4787
Other DBs
NCBI-GeneID: 103345957
NCBI-ProteinID: XP_017194658
Ensembl: ENSOCUG00000024981
LinkDB
Position
Un
AA seq 477 aa
MADGKGSMLEISNDSHEELIFSGNGQFGGVSTLHLAEVCPLRSLQPGTRVKLEESLVPAS
PGRTIAYLSTLLCSYGDFSTVPYFLDQIFHSNMASFLGRCRDLYEAELHGRTSLPLLKMK
VGCKPVSLPGGDLGTQVYFLYALPGHAQHPEAKADAPALRAGPAPFRVLALEPAAAPLAQ
PGPAPESGPASPWGLPPSAQSAPGPAPQASSGWAGTAERLLGEEMVDITAFSPRTMAEQL
TLLDAELFQKVVPFHCLGSVWTKSNKRGKEHLASTVHATVQQFNCVTNCVVTTCLGDPSM
KATDRARVVEHWIKVAKECQTLRNVSSAHAILTALQTSPICRLQETWGEVSSKSCKKFER
LCEKDNGLSRDRLTKKGAFKLAAREKNPQRAQMRLRKQQKGVVPFLGTYLKYLVMLDTVM
GDSVHQADVSFQKLNKEIKVLQEIQLLQVAASKYYFKRDEEFGVWFRSVEFLTEKER
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggcggatgggaaaggctccatgctggagatcagcaatgattcccatgaggaactcatc
ttctcaggcaacggacagtttggaggtgtgtccacactgcacctggcggaggtctgcccc
ctgcggagcctgcagccaggcaccagggtgaagctggaggagtccctggtcccggcatca
ccaggaagaacaatcgcttacctgtccactctgctgtgctcatatggtgacttcagcact
gttccgtatttcctggaccagatattccatagcaacatggcttccttcctgggacgctgc
agagacctgtacgaggcagagctccatggccgcaccagccttccactgctgaagatgaag
gtgggctgcaagcctgtcagccttcctggaggagatctggggacccaggtgtactttctg
tatgccctgcccggacacgcccagcaccctgaggccaaagcagacgctcctgctctgcgt
gcagggccagcacccttccgcgtactggctctggagccagctgcagcaccactggctcag
ccaggacctgctccagagtcagggccagcttccccatggggcctgccaccaagcgcacaa
tcagcaccagggccagctccacaggcctcctctggctgggctgggactgcagagaggctg
cttggggaggagatggttgacatcaccgccttctcccccaggacgatggcagaacagctc
acgcttctggatgcggagctgttccagaaggtcgtgcccttccactgcctgggctccgtc
tggaccaagagcaacaagagaggcaaggaacacctggcctccactgtccatgccaccgtc
cagcagttcaactgcgtgacaaattgtgtagtaaccacatgcttgggggaccccagcatg
aaggccacggacagggcccgtgtggtggagcactggatcaaggtggccaaggagtgccag
accctcaggaacgtttcctcggcccatgccatcctcactgctctgcagacctccccaatt
tgtcgcctgcaagagacgtggggagaagtctccagcaaaagctgcaaaaaatttgagcgc
ctgtgtgagaaggacaatggcttgagcagagatcggctcaccaagaagggtgccttcaag
cttgctgcccgggagaagaatccccagagagcgcagatgaggctgcggaaacaacagaag
ggagtcgtcccctttcttggcacctacctgaaatacctggtgatgttggacactgtgatg
ggggactctgtgcatcaggctgatgtcagcttccagaaactgaataaggaaattaaagtc
ctgcaagaaatccaactactgcaggtggcagcgagcaagtattatttcaagcgtgatgag
gagtttggcgtgtggttccggtccgtggaatttctcactgagaaggagaggtga

KEGG   Oryctolagus cuniculus (rabbit): 103345959
Entry
103345959         CDS       T03373                                 

Definition
(RefSeq) ral-GDS-related protein
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103345959
   04015 Rap1 signaling pathway
    103345959
   04072 Phospholipase D signaling pathway
    103345959
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103345959
   05231 Choline metabolism in cancer
    103345959
  09162 Cancer: specific types
   05210 Colorectal cancer
    103345959
   05212 Pancreatic cancer
    103345959
SSDB
Motif
Pfam: RasGEF
Other DBs
NCBI-GeneID: 103345959
NCBI-ProteinID: XP_008249559
LinkDB
Position
Un
AA seq 538 aa
MFPCCCPSRRGSRRAKAQNEGLFQRVTRWLSSHYGRLWPRGRRQPQGSTLEISNDSREEL
IFSGNGQFGGVSTLHLAEVCPLRSLQPGTGAKLEESLVPASPGRTITYLSALLCSHGDFS
TVPYFLDQIFHSNMASFLGRCRDLYEAELHGNTSLPLLKMKVGCKPVSMPGGDLGTQVYF
LYALPGHAQHPEAKADAPALRAGPAPFCTLALEPAAAPLTQPGPAPEPGPASPWGLPPCA
QSAPGPAPQVSSGWAGTAEELPGVEMVDITTFSPRKMAEQLTLLDAELFQKVVPFHCLGS
VWTKSNKRGKEHLASTVHATVQQFNCVTNCVVTTCLGHPSMKATDRARVVEHWIKVAKEC
QTLRNVSSAHAILTALQTSPICRLQETWGEVSRKSCKKFERLCEKDNGLSRDRLTKKGAF
KLAAREKNPQRAQMRLQKQQKGVVPFLGTYLKYLVMLDTVMGDSVHQADVSFQKLNKEIK
VLQEIQLLQVAASKYYFKRDEEFGLWFRSVEFLTEKESYALSCQLEPPVKKPTSASRP
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgttcccttgctgctgcccttcaaggcgaggctctcgcagagccaaagcccagaatgaa
ggtctcttccagcgtgtaacacgctggctgagctctcactatggacgcctgtggccacgg
gggaggaggcagccacagggctccacgctggagatcagcaatgattcccgtgaggaactc
atcttctcaggcaacggacagtttggaggtgtgtccacactgcacctggcggaggtctgc
cccctgcggagcctgcagccaggcaccggggcaaagctggaggagtccctggtcccggcc
tccccaggaagaaccatcacttacctgtctgctctgctgtgctcacatggcgacttcagt
actgttccgtatttcctggaccagatattccatagcaacatggcttccttcctgggacgc
tgcagagacctgtacgaggcagagctccatggcaacaccagccttccactgctgaagatg
aaggtgggctgcaagcctgtcagcatgcctggaggagacctggggacccaggtgtacttt
ctgtatgccctgcccggacacgcccagcaccctgaggccaaagcagatgctcctgctctg
cgtgcagggccagcacccttctgcacactggctctggagccagctgcagcaccactgact
cagccaggacctgctccagagccagggccagcttccccatggggcctgcccccatgtgca
caatcagcaccagggccagctccacaggtctcctctggctgggctgggactgcagaggag
ctgcctggggtggagatggtagacatcaccaccttctcccccaggaagatggcagaacag
ctcacacttctggatgcggagctgttccagaaagtcgtgcccttccactgcctgggctcc
gtctggaccaagagcaacaagagaggcaaggaacacctggcctccactgtccatgccact
gtccagcagttcaactgcgtgacaaattgtgtagtaaccacatgcttggggcaccccagc
atgaaggccacggacagggcccgtgtggtggagcactggatcaaggtggccaaggagtgc
cagaccctcaggaacgtttcctcggcccatgccatcctcactgctctgcagacctcccca
atttgtcgcctgcaagagacatggggagaagtctccaggaaaagttgcaaaaaatttgag
cgcctgtgtgagaaggacaatggcttgagcagagatcggctcaccaagaagggtgccttc
aagcttgctgcccgggagaagaatccacagagagcacagatgaggctgcagaaacaacag
aagggagtcgtcccctttcttggcacctacctgaaatacctggtgatgttggacactgtg
atgggggactctgtgcatcaggctgatgtcagcttccagaaactgaataaggaaattaaa
gtcctgcaagaaatccaactactgcaggtggcagcgagcaagtattattttaagcgtgat
gaggagtttggcctgtggttccggtctgtggagtttctcacggagaaggagagctacgcc
ctctcctgccagctggagccccctgtcaagaagcccacatcagcctcaaggccatga

KEGG   Oryctolagus cuniculus (rabbit): 103346586
Entry
103346586         CDS       T03373                                 

Definition
(RefSeq) ral-GDS-related protein
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103346586
   04015 Rap1 signaling pathway
    103346586
   04072 Phospholipase D signaling pathway
    103346586
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103346586
   05231 Choline metabolism in cancer
    103346586
  09162 Cancer: specific types
   05210 Colorectal cancer
    103346586
   05212 Pancreatic cancer
    103346586
SSDB
Motif
Pfam: RasGEF DUF4787
Other DBs
NCBI-GeneID: 103346586
NCBI-ProteinID: XP_008251061
UniProt: G1TCK2
LinkDB
Position
Un
AA seq 538 aa
MFPCCCPSRRGSRRAKAQNEGLFQRVTRWLSSHYGRLWPRGRRQPQGSTLEISNDSHEEL
IFSGNGQFGGVSTLHLAEVCPLRSLQPCTGAKLEESLVLASPGRTIAYLSTLLCSYDDFS
TVPYFLDQIFHSNMASFLGRCRDLYEAELHGRTSLPLLKMKVGCKPVSLPGGDLGTQVYF
LYALPGHVQHPEAKADAPALRAGPAPFCVLALEPAAAPLAQPGPAPESGPASPWGLPPSA
QSAPGPAPQASSGWAGTAERLLGEEMVDITAFSPRTMAEQLTLLDAELFQKVVPFHCLGS
VWTERNKRGKEHLASTVRATVQQFNCVTNCVVTTCLKDPKMKATDRARVVEHWIKVAKEC
QTLRNFSSVHAILSALRSTSLYRLKETWGEVSRNSCKKFEHLCEKDNGLSRDRLTKKGAF
KLASREKNPQRAQMRLRKQQKGVVPFLGTYLTDLVMLHTAMGDSVHQADISFQKLNKEIT
VLQEIQLLQVAASKYYFKRDEEFVVWFRSVEFLTENESYALSCQLEPSAKRPAAASRP
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgttcccttgctgctgcccttcaaggcgaggctctcgcagagccaaagcccagaatgaa
ggtctcttccagcgtgtaacacgctggctgagctctcactatggacgcctgtggccacgg
gggaggaggcagccacagggctccacgctggagatcagcaatgattcccatgaggaactc
atcttctcaggcaacggacagtttggaggtgtgtccacactgcacctggctgaggtctgc
cccctgcggagcctgcagccatgcaccggggcaaagctggaggagtccctggtcctggcc
tccccaggaagaaccattgcttacctgtccactctgctgtgctcatatgacgacttcagt
actgttccgtatttcctggaccagatattccatagcaacatggcttccttcctgggacgc
tgcagagacctgtacgaggcagagctccatggccgcaccagccttccactgctgaagatg
aaggtgggctgcaagcctgtcagccttcctggaggagatctggggacccaggtgtacttt
ctgtatgccctgcccggacacgtccagcaccctgaggccaaagcagacgctcctgctctg
cgtgcagggccagcacccttctgcgtactggctctggagccagctgcagcaccactggct
cagccaggacctgctccagagtcagggccagcttccccatggggcctgccaccaagcgca
caatcagcaccagggccagctccacaggcctcctctggctgggctgggactgcagagagg
ctgcttggggaggagatggttgacatcaccgccttctcccccaggacgatggcagaacag
ctcacgcttctggatgcggagctgttccagaaggtcgtgcccttccactgcctgggctcc
gtctggaccgagcgcaacaagagaggcaaggaacacctggcctccactgtccgtgccacc
gtccagcagttcaactgcgtgacaaattgtgtagtaaccacatgtttgaaggaccccaaa
atgaaggccacggacagggcccgtgtggtggagcactggatcaaggtggccaaggagtgc
cagacgctcaggaacttttcctcggtccacgccatcctgtctgctctgcggtccacctct
ctttaccgtctgaaagagacgtggggagaagtctccaggaatagctgcaaaaaatttgag
cacctgtgtgagaaggacaatggcttgagcagggatcggctcaccaagaagggggccttc
aagcttgcttcccgggagaagaatccgcagagagcacagatgaggctgcggaaacaacag
aagggagtcgtcccctttcttggcacctacctgacagacctggtgatgctgcacactgcg
atgggggactctgtgcatcaggctgacatcagcttccagaaactgaataaggaaattaca
gtcctgcaagaaatccaactgttacaggtggcagcgagcaagtattattttaagcgtgat
gaggagtttgtcgtgtggttccggtctgtggagtttctcacggagaacgagagctacgcc
ctctcctgccagctggagccctcagcgaagaggcctgcagcagcctcaaggccatga

KEGG   Oryctolagus cuniculus (rabbit): 103346760
Entry
103346760         CDS       T03373                                 

Definition
(RefSeq) ral guanine nucleotide dissociation stimulator
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103346760
   04015 Rap1 signaling pathway
    103346760
   04072 Phospholipase D signaling pathway
    103346760
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103346760
   05231 Choline metabolism in cancer
    103346760
  09162 Cancer: specific types
   05210 Colorectal cancer
    103346760
   05212 Pancreatic cancer
    103346760
SSDB
Motif
Pfam: RasGEF RasGEF_N
Other DBs
NCBI-GeneID: 103346760
NCBI-ProteinID: XP_008251318
LinkDB
Position
Un
AA seq 570 aa
MVQRMWAEAGGAEPLFPGSRRSRSVWDAVRLEVGGPDSCPVVLHSFTQLDPDLPRLENST
QEIGEELINGVIYSISLRKVQLHHGASKGQRWLGCENESALNLYETCKVRTVKAGTLEKL
VEHLVPAFQGSDLSYVTVFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSRYGCVLPYSS
EDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERRAHLL
LAQLEDPERGDPEPEALSPAPVPALAPSPEPEAAPALEPDTVLAPVLDLQPAPAPAAELA
AELEAALSQTLELDAAPGPGPPLEPPWAAAEDGLSPEKPRLLVFPPELVAEQFTLMDAEL
FKKVVPYHCLGSIWSQRDKKGKEHLAPTIRATVTQFNSVANCVITTCLGDRGMKALDRAR
VVEHWIEVARECRLLKNFSSLYAILSALQSNAIHRLKKTWEEVSRDSFRIFQKLSEIFSD
ENNYSLSRELLIKEGTSKFATLEMNPRRAQRRQREMGVIQGTVPYLGTFLTDLVMLDTAM
KDYLYGRLINFEKRRKEFEVIAQIKLLQSA
NT seq 1710 nt   +upstreamnt  +downstreamnt
atggtgcagcgcatgtgggccgaggcgggcggcgccgagccgctgtttccgggctcccgg
cggagccgcagcgtgtgggacgccgtgcgcctggaggtgggcggccccgacagctgcccg
gtggtgctgcacagcttcacgcagctcgacccggacctgccgcgcctggagaactccacg
caggagatcggtgaggagctgatcaacggggtcatctactccatctccctgcgcaaggtg
cagctgcaccacggagccagcaaggggcagcgctggctcgggtgtgagaacgagtcggcc
ctgaacttgtacgagacctgcaaggtacgcaccgtgaaggcgggcacgctggagaagctg
gtggagcacctggtgcctgccttccagggcagcgacctctcctacgtcaccgtcttcctg
tgcacctacagggccttcaccaccacccagcaggtcttggacctgctgttcaaaaggtac
ggtagatgtgacgccctcacggcctcctctagatacggatgtgtcctcccctactccagc
gaggacggcggaccccaggaccaactcaagaatgccatctcctccatcctgggcacctgg
ctggaccagtactcggaggacttctgccagcccccggacttcccctgcctcaagcagctg
gtggcctacgtgcagctcaacatgcccggctcggacctggagcgccgggcgcacctgctg
ctggcccaactcgaggacccggagcgcggggaccccgagcccgaggctctgtcgccggct
ccggtgccagctctcgcacccagtcccgagccggaggcggcacctgctctggagcccgac
acggtccttgcgccggtcctggacctgcagcccgccccggcgcccgccgcagagctggcg
gcagagctggaggcggctctgtcgcagaccctggagctggacgcggctcccggaccgggg
ccacccttagagcctccctgggcggctgccgaggacgggctgagcccggagaagccgcgc
ctcctggtcttcccgcccgagctggtggccgagcagttcacgctgatggacgcggagctg
ttcaagaaggtggtgccgtaccactgcctgggctccatctggtcgcagcgggacaagaag
ggcaaggagcacctggcgcccaccatccgcgccaccgtcacccagttcaacagcgtggcc
aactgcgtcatcaccacgtgcctcggggaccgcggcatgaaggcgctggacagggcccgg
gtggtggagcactggatagaggtggcccgggagtgtcggctcctcaagaacttctcgtcg
ctctacgccatcctctccgcgctgcagagcaacgccatccaccggctcaagaagacgtgg
gaggaggtgtccagggacagcttccgaatcttccagaaactgtcggagatcttctcggac
gagaacaactactccctgagcagagagctgctcatcaaggaggggacctccaagtttgcc
accctggagatgaaccccaggagagcccagcggcggcagagagagatgggagtcatccag
gggaccgtcccctacctgggcaccttcctcaccgacctggtgatgctggacacggccatg
aaggactatctctatgggcggctgatcaacttcgagaagaggaggaaggagttcgaggtg
atagcgcagatcaagctgctgcagtcggcc

KEGG   Oryctolagus cuniculus (rabbit): 103347195
Entry
103347195         CDS       T03373                                 

Definition
(RefSeq) ral-GDS-related protein
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103347195
   04015 Rap1 signaling pathway
    103347195
   04072 Phospholipase D signaling pathway
    103347195
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103347195
   05231 Choline metabolism in cancer
    103347195
  09162 Cancer: specific types
   05210 Colorectal cancer
    103347195
   05212 Pancreatic cancer
    103347195
SSDB
Motif
Pfam: RasGEF
Other DBs
NCBI-GeneID: 103347195
NCBI-ProteinID: XP_017195954
Ensembl: ENSOCUG00000023696
UniProt: G1U686
LinkDB
Position
Un
AA seq 538 aa
MFPCCCPSRRGSRRAKAQNEGLFQRVTRWLSSHYGRLWPRGRRQPQGSTLEISNDSREEL
IFSGNGQFGGVSTLHLAEVCPLRSLQPCTGAKLEESLVLASPGRTIAYLSTLLCSYDDFS
TVPYFLDQIFHSNMASFLGRCRDLYEAELHGRTSLPLLKMKVGCKHVSLPGGDLGTQVYF
LYALPGHAQHPEAKADAPALRAGPAPFRTLTLEPAAAPLAQPGPAPESGPASPWGLPPCA
QSAPGPAPQASSGWAGTAEELPGAEMVDITAFSPRTMAEQLTLLDAELFQKVVPFHCLGS
VWTERNKRGKEHLASTVRATVQQFNCVTNCVVTTCLKDPKMKATDRARVVEHWIKVAKEC
QTLRNFSSVHAILSALRSTSLYRLKETWGEVSRKCCKKFEHLCEKDNGLSRDRLTKKGAF
KLASREKNPQRAQMRLRKQQKGVVPFLGTYLTDLVMLHTAMGDSVHQADISFQKLNKEIT
VLQEIQLLQVAASKYYFKRDEEFVVWFRSVEFLTENESYALSCQLEPSAKRPAAASRP
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgttcccttgctgctgcccttcaaggcgaggctctcgcagagccaaagcccagaatgaa
ggtctcttccagcgtgtaacacgctggctgagctctcactatggacgcctgtggccacgg
gggaggaggcagccacagggctccacgctggagatcagcaatgattcccgtgaggaactc
atcttctcaggcaacggacagtttggaggtgtgtccacactgcacctggctgaggtctgc
cccctgcggagcctgcagccatgcaccggggcaaagctggaggagtccctggtcctggcc
tccccaggaagaaccattgcttacctgtccactctgctgtgctcatatgacgacttcagt
actgttccgtatttcctggaccagatattccatagcaacatggcttccttcctgggacgc
tgcagagacctgtacgaggcagagctccatggccgcaccagccttccactgctgaagatg
aaggtgggctgcaagcatgtcagccttcctggaggagatctggggacccaggtgtacttt
ctgtatgccctgcccggacacgcccagcaccctgaggccaaagcagacgctcctgctctg
cgtgcagggccagcacccttccgcacactgactctggagccagctgcagcaccactggct
cagccaggacctgctccagagtcagggccagcttccccatggggcctgcccccatgcgca
caatcagcaccagggccagctccacaggcctcctctggctgggctgggactgcagaggag
ctgcctggggcggagatggttgacatcaccgccttctcccccaggacgatggcagaacag
ctcacgcttctggatgcggagctgttccaaaaggtcgtgcccttccactgcctgggctcc
gtctggaccgagcgcaacaagagaggcaaggaacacctggcctccactgtccgtgccacc
gtccagcagttcaactgcgtgacaaattgtgtagtaaccacatgtttgaaggaccccaaa
atgaaggccacggacagggcccgtgtggtggagcactggatcaaggtggccaaggagtgc
cagaccctcaggaacttttcttcggtccacgccatcctgtctgctctgcggtccacctct
ctttaccgtctgaaagagacgtggggagaagtctccaggaaatgctgcaaaaaatttgag
cacctgtgtgagaaggacaatggcttgagcagggatcggctcaccaagaagggagccttc
aagcttgcttcccgggagaagaatccgcagagagcacagatgaggctgcggaaacaacag
aagggagtcgtcccctttcttggcacctacctgacagacctggtgatgctgcacactgcg
atgggggactctgtgcatcaggctgacatcagcttccagaaactgaataaggaaattaca
gtcctgcaagaaatccaactgctacaggtggcagcgagcaagtattattttaagcgtgat
gaggagtttgtcgtgtggttccggtctgtggagtttctcacggagaacgagagctacgcc
ctctcctgccagctggagccctcagcgaagaggcctgcagcagcctcaaggccatga

DBGET integrated database retrieval system