KEGG   Oryctolagus cuniculus (rabbit): 103346471
Entry
103346471         CDS       T03373                                 

Gene name
SSU72
Definition
(RefSeq) SSU72 homolog, RNA polymerase II CTD phosphatase
  KO
K15544  RNA polymerase II subunit A C-terminal domain phosphatase SSU72 [EC:3.1.3.16]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    103346471 (SSU72)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ocu03021]
    103346471 (SSU72)
   03019 Messenger RNA biogenesis [BR:ocu03019]
    103346471 (SSU72)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103346471 (SSU72)
Transcription machinery [BR:ocu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     103346471 (SSU72)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     103346471 (SSU72)
SSDB
Motif
Pfam: Ssu72
Other DBs
NCBI-GeneID: 103346471
NCBI-ProteinID: XP_008250806
LinkDB
Position
Un
AA seq 194 aa
MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTT
YDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCRDLFDLILTCEERVYDQVV
EDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIEELLQEFE
EKSGRAFLHTVCFY
NT seq 585 nt   +upstreamnt  +downstreamnt
atgccgtcttcaccgctgcgggtggcggtggtgtgctccagtaaccagaaccggagcatg
gaggcgcacaacatcctcagcaaacgaggatttagcgtccgatcctttggaacgggaact
catgtgaagcttccaggaccagcacccgacaagccaaatgtttacgattttaaaaccaca
tacgatcagatgtacaatgaccttcttagaaaagacaaagaactctacacccagaacggc
atcttgcacatgctggacagaaacaagcggatcaagccccggccagagaggttccagaac
tgcagagacctgtttgacctgatcctcacctgcgaggagcgcgtctacgaccaggtggtg
gaggacctgaattcccgggagcaggagacctgccagccggtgcacgtggtcaacgtggac
atccaggacaaccacgaggaggccaccctgggggccttcctcatctgcgagctctgccag
tgtatccagcacacggaggacatggagaacgagatcgaggagctgctgcaggagttcgag
gagaagagcggccgggccttcctgcacaccgtgtgcttctactga

DBGET integrated database retrieval system