KEGG   Oryctolagus cuniculus (rabbit): 103346571
Entry
103346571         CDS       T03373                                 

Gene name
IRF3
Definition
(RefSeq) interferon regulatory factor 3
  KO
K05411  interferon regulatory factor 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103346571 (IRF3)
   04621 NOD-like receptor signaling pathway
    103346571 (IRF3)
   04622 RIG-I-like receptor signaling pathway
    103346571 (IRF3)
   04623 Cytosolic DNA-sensing pathway
    103346571 (IRF3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103346571 (IRF3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103346571 (IRF3)
   05133 Pertussis
    103346571 (IRF3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103346571 (IRF3)
   05162 Measles
    103346571 (IRF3)
   05164 Influenza A
    103346571 (IRF3)
   05161 Hepatitis B
    103346571 (IRF3)
   05160 Hepatitis C
    103346571 (IRF3)
   05168 Herpes simplex virus 1 infection
    103346571 (IRF3)
   05163 Human cytomegalovirus infection
    103346571 (IRF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103346571 (IRF3)
   05169 Epstein-Barr virus infection
    103346571 (IRF3)
   05165 Human papillomavirus infection
    103346571 (IRF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    103346571 (IRF3)
   04131 Membrane trafficking [BR:ocu04131]
    103346571 (IRF3)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    103346571 (IRF3)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    103346571 (IRF3)
SSDB
Motif
Pfam: IRF-3 IRF DUF4741
Other DBs
NCBI-GeneID: 103346571
NCBI-ProteinID: XP_008251035
LinkDB
Position
Un
AA seq 435 aa
MPVAGRPKRGETGGSMGTQKPRILPWLIQQLDLGQLEGVSWVDEHRKRFRIPWKHGLRQD
AQPQDFGIFQAWAEASGAYTPGDRPDLPTWKRNFRSALNRKEVVRLAEDRSKDPHDPHKV
YEFVTSGAGDISPEVQGDSTSESQEDELEQLLGDMGLAAGPDEGPWAGAVAPECCPQLLL
SPHLDHPGPCPHPAPPENPLRQLLVPEEQWEFEVTAFYRGRQVFQQTICCPGGLRLVGPE
AAARTLPGQPVALPDPGTALSDGSVSCYVRRVLQSLEGGLALWQLGPRLCARRLGHCHTY
WAVGEELLPNSGHGPAGEVPKDQDGSVFELGPFVADLIAFMEGSGHSPRYTLWFCLGEAW
PQDQPWVKRLVMVKVVPMCLKALLDMARAGGASSLENSVDLHISNSQPLSLTSDQYKAYL
QDLMEDMDFQVTGEP
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgcctgtggccggaagaccgaaaaggggcgagacgggcgggagcatggggacgcagaag
ccgcggatcctgccctggctgatccagcagctggacctggggcagctggagggcgtgtcg
tgggtggacgagcaccggaagcgcttccggataccttggaagcacgggctgcggcaggat
gcgcagccgcaggacttcggcatcttccaggcctgggcagaggccagcggcgcctatact
cccggggataggcccgacctgccaacctggaagaggaacttccggtccgccctaaaccgg
aaggaagtggtgcgtttagctgaggaccggagcaaggaccctcacgacccgcacaaggtc
tacgagtttgtgacctcaggagctggggacatctctcccgaagttcagggggacagtacc
tctgagagccaggaagacgagctggagcagctcctgggcgacatgggcctggcggccggc
ccggacgaggggccctgggctggggctgtggcccctgagtgctgccctcagctcttgctg
agccctcacctggaccaccccggcccctgcccgcaccccgcaccccctgaaaacccactg
aggcagctgctggtgcccgaggaacagtgggagttcgaggtgaccgccttctaccggggc
cgccaggtcttccagcagaccatctgctgcccaggaggcctgcggctcgtgggcccggaa
gccgcagccaggacgctgccggggcagccggtagccctgccggaccccgggacggccctg
tctgacgggagcgtgagctgctacgtgcgacgcgtgctccagagcctggaggggggactg
gccctgtggcagctggggcctcggctctgtgcccggcggctggggcactgccacacctac
tgggccgtgggggaggagctgctccccaacagcgggcacgggcccgccggcgaggtcccc
aaggaccaggacggaagcgtgttcgagctggggcccttcgtggcagatctgatcgcgttc
atggaaggaagcggacactcacctcgctacaccctctggttctgtttgggggaggcctgg
ccccaggaccagccgtgggtcaagaggctcgtgatggtcaaggtcgtgcccatgtgcctc
aaggccctgttagacatggccagggcagggggcgcctcctccctggagaacagcgtggac
ctgcacatttccaacagccagccgctctccctcacctccgaccagtacaaggcctacctg
caggacctgatggaggacatggatttccaagtcactggggagccctga

DBGET integrated database retrieval system