KEGG   Oryctolagus cuniculus (rabbit): 103346753
Entry
103346753         CDS       T03373                                 

Gene name
FADD
Definition
(RefSeq) Fas associated via death domain
  KO
K02373  FAS-associated death domain protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05142  Chagas disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103346753 (FADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103346753 (FADD)
   04215 Apoptosis - multiple species
    103346753 (FADD)
   04217 Necroptosis
    103346753 (FADD)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103346753 (FADD)
   04621 NOD-like receptor signaling pathway
    103346753 (FADD)
   04622 RIG-I-like receptor signaling pathway
    103346753 (FADD)
   04657 IL-17 signaling pathway
    103346753 (FADD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103346753 (FADD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103346753 (FADD)
   05022 Pathways of neurodegeneration - multiple diseases
    103346753 (FADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103346753 (FADD)
   05152 Tuberculosis
    103346753 (FADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103346753 (FADD)
   05162 Measles
    103346753 (FADD)
   05164 Influenza A
    103346753 (FADD)
   05161 Hepatitis B
    103346753 (FADD)
   05160 Hepatitis C
    103346753 (FADD)
   05168 Herpes simplex virus 1 infection
    103346753 (FADD)
   05163 Human cytomegalovirus infection
    103346753 (FADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103346753 (FADD)
   05169 Epstein-Barr virus infection
    103346753 (FADD)
   05165 Human papillomavirus infection
    103346753 (FADD)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103346753 (FADD)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103346753 (FADD)
SSDB
Motif
Pfam: DED Death Ntox34 EAL
Other DBs
NCBI-GeneID: 103346753
NCBI-ProteinID: XP_008251312
Ensembl: ENSOCUG00000015189
LinkDB
Position
Un
AA seq 203 aa
MDPFLGLLHSLSSGLSSSELTELKFLCHGRVGKRKLERVQSGLDLFSVLLEQSDLEPERT
ELLRELLTELRRHDLLRRLDAFEAGAAGGPAPGAEDLRVAFDIVCDNVGREWRRLARQLQ
VSDAKIDGIEERFPRNLSERVRAALRVWKDAQKEGATVARLVEALRRCGMNLVADLVEEE
QQARGARDQGGAVSPMSWDSGAP
NT seq 612 nt   +upstreamnt  +downstreamnt
atggatccgtttctggggctgctgcactcgctgtcgtccgggctgtcgagcagcgagctg
accgagctcaagttcctgtgccacgggcgcgtgggcaagcggaagctggagcgcgtgcag
agcggcctggacctcttctcggtgctgctggagcagagcgacctggagcccgagcgcacc
gagctgctgcgcgagctgctgaccgagctgcggcgccacgacctgctgcggcgcctggac
gccttcgaggcgggggcggcgggcgggccggcgccgggggccgaagacctgcgtgtggcc
ttcgacatcgtgtgcgacaacgtgggcagggagtggcggaggctggcccggcagctccag
gtctcggacgccaagatcgacggcatcgaggagcgctttccccggaacctgtcggagcgg
gtgagggcggcgctgagagtctggaaggacgcgcagaaggagggtgccaccgtggcccgc
ctcgtggaggcgctcaggcgctgcggcatgaacctggtggccgacctggtggaggaggag
cagcaggcccggggcgcccgggaccagggcggggccgtgtccccgatgtcgtgggactcc
ggagcaccctga

DBGET integrated database retrieval system