KEGG   Oryctolagus cuniculus (rabbit): 103346801
Entry
103346801         CDS       T03373                                 

Gene name
BIRC5
Definition
(RefSeq) baculoviral IAP repeat containing 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04390  Hippo signaling pathway
ocu05161  Hepatitis B
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    103346801 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103346801 (BIRC5)
   04215 Apoptosis - multiple species
    103346801 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103346801 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103346801 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103346801 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103346801 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    103346801 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    103346801 (BIRC5)
Peptidases and inhibitors [BR:ocu01002]
 Peptidase inhibitors
  Family I32: IAP family
   103346801 (BIRC5)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     103346801 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103346801 (BIRC5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 103346801
NCBI-ProteinID: XP_017195702
LinkDB
Position
Un
AA seq 142 aa
MDARSLPRAWQLYLKDHRVSTFKNWPFLEGCACTPERMAEAGFIHCPSENEPDLAQCFFC
FKELEGWEPDDEPLEEHRKHSPACAFLSVKKQLEELTLSEFLKLDKERAKNKIAKETSSK
QKEFEETAKKVRSAIEQLAALQ
NT seq 429 nt   +upstreamnt  +downstreamnt
atggacgcccggtcgttgccccgggcttggcagctctatctcaaggaccaccgcgtctcg
acgttcaagaactggcccttcctggagggctgcgcctgcaccccggagcggatggccgag
gccggcttcatccactgcccctctgagaacgagcccgacctggcccagtgtttcttctgc
ttcaaggagctcgagggctgggagccggacgacgagcccctggaggagcacaggaagcac
tcgcccgcgtgcgcgttcctgtctgtcaagaagcagctggaagaactgacgctcagcgag
tttctgaagctggacaaagagcgagccaagaacaagatcgccaaggagaccagcagtaag
cagaaggagttcgaggagaccgcgaagaaggtgcgctccgccatcgagcagctggccgcg
ctgcagtga

DBGET integrated database retrieval system