KEGG   Oryctolagus cuniculus (rabbit): 103347590Help
Entry
103347590         CDS       T03373                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00052  Galactose metabolism
ocu00500  Starch and sucrose metabolism
ocu01100  Metabolic pathways
ocu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103347590 (GAA)
   00500 Starch and sucrose metabolism
    103347590 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103347590 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    103347590 (GAA)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103347590 (GAA)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103347590 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 103347590
NCBI-ProteinID: XP_008252325
LinkDB All DBs
Position
Un
AA seq 722 aa AA seqDB search
MDGRWPPCSRPLLGVCVLVALATAAFLGHSLLCAFPLVPRELGGIFRGPGDTSRPLLWPA
QERPGRPGATPTQCDVPPNSRFDCAPDRAITQEQCEARGCCYAPTRRRPQGPRIGQPWCY
FPPSYPSYRMQDLSPSEMGYTATLTRATPTFFPKDILTLRLDVLMETDSRLHFPIKDPAD
RRYEVPLETPRVHSRAPSPLYSVAFSEEPFGVIVRRKLDGRVLLNTSVAPLFFADQYLQL
STALPSRLLTGLGEHLSPLMLTADWARVTLWNRDVPPTPNVNLYGSHPFYLALEDGGTAH
GVFLLNSNAMDVVLQPSPALTWRSTGGILDLYVFLGPEPKSVVQQYLDVVGYPFMPPYWG
LGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNRDGFADFPAMV
HQLHQGGRRYVMIVDPAISSSGPPGSYRPYDEGLRRGVFITNETGQPLTGKVWPGPSAFP
DFTNPETLDWWQDMVAEFHAQVPFDGMWIDMNEPSNFVRGSEYGCPNNTLEKPPYLPGVA
GGALQAATICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISRSTFSGHGR
YAGHWTGDVWSTWEHLSSSVPEVLQFNLLGVPLVGADVCGFLGDSSEELCVRWTQLGAFY
PFMRNHNDLHSQPQEPYRFSEAAQQAMRKALGLRYALLPHLYTLFHKAHVRGDTVARPLF
LE
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggacgggaggtggccgccctgctcccgccccctgctgggggtctgtgtgctcgtcgcc
ttggctacggcggccttcctgggccacagtctgctctgtgccttcccactggtcccccgg
gagctgggtggcatcttccgaggcccgggggacaccagccggccgctgctctggcctgcg
caggagcgccctggccgtcctggggccacacccacacagtgcgatgtcccccccaacagc
cgcttcgactgtgccccggacagagccatcacacaggagcagtgcgaggcccgcggctgc
tgctatgcgcccacgaggcggaggccacagggtccacgtatcgggcagccctggtgctac
ttcccacccagctaccccagttacaggatgcaggacctgagcccctccgagatgggctac
acagccaccctgacgcgtgccacccccacttttttccccaaggacatcctgaccctgcgg
ctggacgtgctgatggagaccgacagccgcctgcacttcccgatcaaagaccccgcggac
aggcgctacgaggtgccgctggagacgccacgcgtgcacagccgggcgccgtcccccctc
tacagcgtggccttctcggaggagcccttcggggtgattgtgcgccggaagctggacggc
cgggtgctgctgaacacgagcgtggcgccgctgttcttcgccgaccagtatctgcagctg
tccacggcgctgccctcgcggctgctcaccgggctgggcgagcacctcagcccgctcatg
ctcaccgccgactgggccagggtcaccctctggaaccgggacgtgccccccacgcccaac
gtcaacctgtacgggtcgcaccctttctacctggcgctggaggacggcggcacggcccac
ggggtgttcttgcttaacagcaacgccatggatgtggtcctgcagccgagccccgccctc
acttggcgatcgacgggcgggatcctggacctgtatgtgttcctgggccccgagcccaag
agtgtggtgcagcagtacctggacgtcgtggggtacccgttcatgccgccctactggggc
ctgggcttccacctgtgccgctggggctactcgtccacggccatcacccgccaggtggtg
gagaacatgacccgggcccacttccccctggacgtgcagtggaatgacctggactacatg
gactcccggagagacttcaccttcaacagggacggcttcgccgacttcccggccatggtg
caccagctgcaccagggcggccggcgctacgtgatgattgtggaccctgccatcagcagc
tcgggccctcccgggagctaccgaccctacgatgagggcctgcggagaggggtctttatc
accaacgagacggggcagccgctgacggggaaggtgtggccgggaccttccgccttccct
gacttcaccaaccccgagaccctcgactggtggcaggacatggtggccgagttccacgcc
caggtgcccttcgacggcatgtggatcgacatgaacgagccgtccaacttcgtcaggggc
tccgagtacggctgtcccaacaacaccctggagaagccgccgtacctgccaggagtggcg
ggcggggccctccaggcagccaccatctgtgcctccagccaccagttcctgtccacgcac
tacaacctgcacaacctgtacggcctgaccgaagccatcgcctcccacagggccctggtg
aaggctcggggaacacgcccattcgtcatttcccgttcgaccttctctggccacggccga
tatgctggccactggacaggggacgtgtggagcacctgggagcatctctcctcctccgtg
ccagaagtcctgcagttcaacctgctgggggtgcccctggtgggggcggacgtctgtggc
ttcctgggcgacagctcagaggagctgtgtgtgcgctggacccagctgggcgccttctac
cccttcatgcgcaaccacaacgacttgcacagccagccccaggagccctacaggttcagt
gaggccgcacagcaggccatgaggaaggccctgggcctgcgctacgcgctgctgccgcac
ctctacacgctcttccacaaggcccacgtccgaggggacaccgtggcccggcccctcttc
ctggagtga

DBGET integrated database retrieval system