KEGG   Oryctolagus cuniculus (rabbit): 103348383
Entry
103348383         CDS       T03373                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic peptidase activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05134  Legionellosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103348383 (APAF1)
   04215 Apoptosis - multiple species
    103348383 (APAF1)
   04115 p53 signaling pathway
    103348383 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103348383 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    103348383 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103348383 (APAF1)
   05012 Parkinson disease
    103348383 (APAF1)
   05014 Amyotrophic lateral sclerosis
    103348383 (APAF1)
   05016 Huntington disease
    103348383 (APAF1)
   05020 Prion disease
    103348383 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    103348383 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    103348383 (APAF1)
   05152 Tuberculosis
    103348383 (APAF1)
  09172 Infectious disease: viral
   05162 Measles
    103348383 (APAF1)
   05164 Influenza A
    103348383 (APAF1)
   05161 Hepatitis B
    103348383 (APAF1)
   05160 Hepatitis C
    103348383 (APAF1)
   05168 Herpes simplex virus 1 infection
    103348383 (APAF1)
   05169 Epstein-Barr virus infection
    103348383 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103348383 (APAF1)
SSDB
Motif
Pfam: WD40 APAF1_C NB-ARC ANAPC4_WD40 CARD WD40_like Ge1_WD40 eIF2A CARD_2 Nup160 IBN_N
Other DBs
NCBI-GeneID: 103348383
NCBI-ProteinID: XP_017197657
LinkDB
Position
4
AA seq 1808 aa
MDAKARNCLLQHREALEKDIKTSCIIDHMVSDGVLTLLEEEKVKNECTQRQRAAMLIKMI
LKKDNNSYISFYNALLYEGYKDLAALLHGGIPVVSGSSGKDSVGGITSYGLYPLHRSPGF
DGVRATMDPNTIIEALRGTMDPALREAAERQLNEAHKSLNFVSTLLQIAMSEQLDLPCTL
LLELINQQNQTEWIEILKIVVNRDVPNETLQVEEDDRPELPWWKCKKWALHSLARLFERY
GSPGNISKEYNEFAEVFLKAFAVGVQQVLLKVLYHSDLGYMRARACWVLHYFCEVKFKSD
QNLQTALELTRRCLIDDREMPVKVEAAIALQVLISNQEKAKEYITPFIRPVMQALLHIIR
ETENDDLTNVVQKMICEYSEEVTPSAVEMTQHLAMTFNQYVQKVLTGVAGEDAECHAAKL
LEVIILQCKGHGIDQCIPLFVEAALERLTREVKTSELRTMCLQVAIAALYYNPHLLLNTL
ENLRFPNNVEPVTNHFITQWLNDVDCFLGLHDRKMCVLGLCALIDTEQIPQVLNQVSGQI
LPAFILLFNGLKRAYACHAEHENDSDEDDEAEDDDDTEELGSDKDDIDEGGQEYLEILAK
QAGGDGDDEAWEEDDAEETALEGYSTIIDDEDNPVDEYQIFKAIFQTIQNCNPVWYQALT
HGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGRDLNSCGGRYQEAVNHSIMYNEELSC
PVKSYPVQNIESAKGCFPGGVHWVSVGQQDKAKLLMKLQNLCSRLDQDESFFQRLPLNIE
EAKDRLRILMLHKHPRSLLILDDVWDPWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVVP
VESSLGKEKGLEILSLFVNMKKTDLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYY
LRQLQNKQFKRIRKSSSYDYEALDEAMSISVDVLREDIRDYYTDLSIFQKDVKVPTKVLC
ILWDMETEEVEDILQEFVNKSLLFCDRNGKSFSYYLHDLQVDFLTEKNRSQLQDLHKKVV
TQFQRYHQLYTLSPDQEDCMYWYNFLAYHMASANMHKELCALMFSLDWIKAKTELVGPAH
LIHEFVEYRHILDEKDCTVCENFQEFLSLNGHLLGRQPFPNIIQLGLCEPETSEVYQQAK
LQAKQEVDNGMLYLEWINKKNIKNLSRLVVRPHTDAVYHACFSADGQRIASCGADKTLQV
FKAETGEKLLEIKAHEDEVLCCTFSTDENFIATCSVDRKVKIWNSVTGELVRTYDEHSEQ
VNCCCFTNQSQYLLLATGSSDFFLKLWDLNQNVCRNTMFGHTNSVNHCRFSPDDKLLSSC
SADGTLKLWDVKSANEVKSINVKKFFLTSEDPQEDMEVIVKCCSWSADGARIMVAAKNKI
LVFDFHTSDLLAEIQTGRNSTIQYCDFSPHNHLAVVALSQYCVELWNMDSRLKVADCRGH
LSWVHGVMFSPDGSSFLTSSDDQTIRVWETKKVCKNSAIVLKQEVDVVFQENEVMVLAVD
DVRCLQLINGKTGQIDYLTEAQVSCCCLSPHLQYIAFGDEDGTIEILELLNSRIFQSRIG
HKKTVRHIQFTADGKTLISSSDDSAIQVWNWQTDEYVFLQAHQETVTDFRLLKNSRLLSW
SFDGTVKVWNIITGRIEKDFVCHQATVLSCDISPDATKFSSTSADKTAKIWTFELLSPLH
ELRGHNGCVRCSAFSVDSSLLATGDDNGEIRIWNVSNGELLHLFAPVSVEEGAATHGGWV
TDLCFSPDSKMLVSAGGYLKWWNVVTGESLQTFYTNGTSLKKIHVSPDFKTYVTVDNLGI
LYILQVLE
NT seq 5427 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcggaattgtttattgcaacatagagaagctctggaaaaagacatc
aagacatcctgcatcatagatcacatggttagcgatggagttttgacattactggaagaa
gaaaaagtgaaaaatgagtgtactcaacgtcaacgagcagctatgctaattaaaatgata
cttaagaaagataataattcttacatctcattctacaatgctctgctttatgaaggatat
aaggatcttgcggcccttctccatggtggcattcctgttgtctctggttccagtggcaaa
gattcagttggtggaataacttcatatggtttgtatccattgcaccggagtcctgggttt
gacggagtccgcgctaccatggaccccaacaccataatcgaggccctacggggcaccatg
gacccagccttacgtgaggccgcggagcgccagctcaacgaagcacacaagtctctgaat
tttgtttcaacactgctgcagattgctatgtcagaacaactggacttaccttgtacacta
ctgctggagctgataaaccaacagaaccagacagagtggatagaaattttaaagattgtt
gtgaacagagatgtacctaatgaaacacttcaagttgaagaagatgatagacctgagtta
ccatggtggaaatgtaagaagtgggctttacatagtttagcaaggctctttgagagatat
ggaagccccggcaatatttccaaggagtataatgaatttgctgaagtatttttgaaggca
tttgctgttggtgtccagcaagttttgttgaaggtattatatcacagtgatctaggctac
atgagagcacgggcttgctgggtacttcactatttttgtgaagtgaagttcaaaagtgac
cagaaccttcaaacagctttagaactaacaaggagatgtctgattgatgacagagaaatg
cctgtgaaagtggaagctgcaatagctcttcaagtgttgataagcaatcaagaaaaagct
aaagaatacatcacaccattcatcagacctgtaatgcaggctcttcttcatattataaga
gaaacagaaaatgatgatcttaccaatgtagttcagaaaatgatttgtgaatatagtgaa
gaagttactcctagtgcagtagaaatgacacaacatttggcaatgacatttaaccagtat
gtgcaaaaggttcttacaggagttgcaggagaagatgcagagtgtcacgcagcaaaatta
ttagaggtcatcattctgcagtgcaaagggcatggcattgaccagtgcattcccttattc
gtggaagcagctttagagagactgacaagagaagttaagacaagtgaacttagaacaatg
tgtctgcaagttgcaattgcagctttatattataacccacacctactacttaatacttta
gaaaatcttcgcttccctaataatgttgaaccagttacaaatcattttattacacagtgg
cttaatgatgttgactgtttcttggggctccatgaccgaaagatgtgtgttcttggcctg
tgtgctcttattgatacggaacaaataccacaggttttaaatcaggtttctggacagatt
ttgccagcttttatccttctatttaatggattgaaaagagcatatgcctgccatgcagaa
catgagaatgacagtgatgaggatgatgaagctgaagatgatgatgacactgaggaactg
gggagtgacaaggatgatattgatgaaggtggtcaagaatatttggagattctggctaag
caagcaggtggagatggagatgatgaggcctgggaagaagatgatgctgaggaaactgct
ctagaaggctattccacaatcattgatgatgaagataaccctgttgatgagtatcagata
tttaaagctatatttcagactattcaaaactgtaatcctgtgtggtatcaggctctgact
catggtcttaatgaagaacaaaggaaacagttacaagacatagcaactctggctgatcaa
agaagagcagcccatgaatccaaaatgattgagaagcatggaagggacttgaattcgtgt
gggggaagataccaagaggctgttaatcattctataatgtacaatgaagaattatcctgt
ccagtgaagagctatcctgtccaaaatatcgagagtgctaagggttgtttcccgggaggt
gtgcattgggtttcagttgggcagcaggacaaagctaagcttctgatgaaactgcagaat
ctctgctcacgattggatcaggatgagagtttcttccagaggcttccacttaacattgaa
gaggctaaagaccgtctccgcattctgatgctgcacaaacacccaaggtctctgttgatc
ttggatgatgtttgggatccttgggtgttaaaagcttttgacaatcaatgtcagattctt
cttacaaccagagataagagtgttacagattcagtaatgggtcctaaatatgtagtccct
gtggagagtagcctaggaaaagaaaaaggacttgaaattttatccctatttgttaatatg
aagaaaacagatttgccagaacaagctcatagtattataaaagaatgtaaaggttctcct
cttgtagtgtctttaattggtgcacttttacgtgattttcccaaccgctgggagtactac
ctcaggcagcttcagaataagcaatttaagagaataaggaaatcttcatcttatgattat
gaagctctggatgaagccatgtccataagtgttgatgtactcagagaagacatcagagat
tattacacagatctttccatctttcagaaagatgttaaggttcctacaaaggtgttatgt
attctctgggacatggaaactgaagaagttgaagacatactgcaggaatttgttaataag
tctctcttattttgtgatcggaatggaaaatcattttcttactatttacatgatctccaa
gtagattttcttacagagaagaatcgcagccagcttcaggatctacataaaaaggtggtc
actcagttccagaggtatcaccagctatacactctctcccctgatcaggaggactgcatg
tattggtacaactttctggcctaccacatggccagtgcgaatatgcacaaagaactttgt
gctttaatgttttccctggattggattaaagcaaaaacagaacttgttggccctgctcat
ctgattcatgaatttgtggaatataggcatatattggatgaaaaggattgtacagtttgt
gaaaattttcaggagtttttatctttaaatggacaccttcttggacgacagccatttcct
aacattatacagctgggtctctgtgaaccggaaacttcagaagtttatcagcaagctaag
ctgcaggccaagcaggaggtcgataacggaatgctttacctggagtggataaacaaaaaa
aacatcaagaatctctcccgcttagttgtccgcccccatacagatgctgtttaccacgcc
tgcttttctgcggatggtcagagaatagcctcttgcggagctgacaaaaccttgcaggtg
ttcaaagctgaaacaggagagaaacttctagaaatcaaggctcatgaagatgaagtactt
tgttgtacattctctacagatgaaaattttatagcaacctgctcagtggataggaaagtg
aagatttggaattctgtgactggggaactagtacgtacttatgatgagcactcagagcaa
gtcaactgctgctgtttcaccaaccaaagtcagtaccttctcttggccactgggtcaagt
gacttcttcctcaaactctgggatttgaatcaaaacgtatgccgaaatacgatgtttggt
catacaaattcagtcaatcattgcagattttcaccagatgataaacttttgtctagttgt
tcagctgatggaacactaaagctttgggatgtgaaatcagcaaatgaggtgaaaagcatc
aatgtgaagaaattcttcctaacttcagaggacccgcaagaggatatggaagtaatagtg
aaatgttgttcgtggtctgctgatggtgctaggataatggtggcagcaaaaaataagatc
cttgtttttgactttcataccagtgacctattggccgaaatccaaacaggccgtaacagc
actatccagtattgtgacttttcccctcataatcatttggcagtggtggctttgtctcaa
tactgtgtggagttgtggaatatggactcacgtttaaaggtagctgattgccgaggacat
ttaagttgggttcatggtgtgatgttttctcctgatggatcatcatttttgacatcttct
gatgaccagactatcagggtctgggagactaagaaggtatgtaagaactctgcaatagtg
ttaaaacaagaagtcgatgttgtttttcaagaaaatgaagtgatggtccttgcggttgat
gatgtaagatgtctacaactcattaatggaaaaacaggtcagattgattacctgactgaa
gctcaagttagctgctgttgcttaagtccgcatcttcagtacattgcatttggagatgaa
gatggaaccattgagattttagaacttctaaacagcagaatcttccagtccaggattggg
cacaagaaaactgtacggcatattcagttcacagctgatgggaagactctgatttcaagt
tctgatgattctgcaattcaggtatggaattggcagacagatgaatatgtcttccttcaa
gcccatcaggaaactgtgacggattttaggctcttgaaaaattcaagactactttcttgg
tcatttgatggaacagttaaggtatggaatattattactggaagaatagaaaaagacttt
gtctgtcaccaggccactgtactttcttgtgatatttctcctgatgcaaccaagttttca
tctacctcagctgataagactgcaaagatttggacttttgaactcctttcccctcttcat
gagttgaggggccacaatggctgcgtccgctgttctgccttttctgtggacagttccctg
ctggcgacaggagatgacaacggagagatcaggatatggaatgtctccaatggagagctg
cttcatctgtttgcgcccgtttcggtagaagagggagctgccacccatggaggctgggtg
actgatctttgcttttctccagatagcaaaatgcttgtctctgctggaggatatcttaag
tggtggaatgttgtcactggggaatccttacagaccttctacacaaatggaaccagtctt
aagaaaatccatgtgtctcctgacttcaaaacatatgtgactgttgacaatcttggtatt
ttatatattttacaggttttagagtaa

DBGET integrated database retrieval system