KEGG   Oryctolagus cuniculus (rabbit): 103349340
Entry
103349340         CDS       T03373                                 

Gene name
CXXC1
Definition
(RefSeq) CXXC finger protein 1
  KO
K14960  COMPASS component SPP1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    103349340 (CXXC1)
   03036 Chromosome and associated proteins [BR:ocu03036]
    103349340 (CXXC1)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Zinc finger
   CXXC CpG-binding proteins
    103349340 (CXXC1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    COMPASS/SET1 complex
     103349340 (CXXC1)
    COMPASS/SET1 complex (yeast)
     103349340 (CXXC1)
SSDB
Motif
Pfam: CpG_bind_C zf-CXXC PHD
Other DBs
NCBI-GeneID: 103349340
NCBI-ProteinID: XP_017199664
Ensembl: ENSOCUG00000025756
UniProt: G1U1F9
LinkDB
Position
9
AA seq 655 aa
MEGDGSDPEPPDAGEDSKSENGENAPIYCICRKPDINCFMIGCDNCNEWFHGDCIRITEK
MAKAIREWYCRDCREKDPKLEIRYRHKKSRERDGSERDGSEPRDEGGGRKRPIPDPDLQR
RAGSGTGVGAMLARGSASPHKSSPQPLMVIPSQXHQQQQQIKRSARMCGECEACRRTEDC
GHCDFCRDMKKFGGPNKIRQKCRLRQCQLRARESYKYFPSSLSPVTPSESLPRPRRPLPT
QQQPQPSQKLGRIREDEGAVASAAVKEPPEATATPEPLSDEDLPLDPDLYQDFCAGAFDD
HGLPWMSDTEESPFLDPALRKRAVKVKHVKRREKKSEKKKEERYKRHRQKQKHKDKWKHP
ERADAKDPASLPQCLGPGCVRAAQPGSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCI
AEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIILRAKQQAVREDEESNENDSDDTD
LQIFCVSCGHPINPRVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKTY
CKRLQVLCPEHSRDPKVPADEVCGCPLVRDVFELTGDFCRLPKRQCNRHYCWEKLRRAEV
DLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPLTTDLRSSADR
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggagggagatggttcagacccagagcctccagatgctggggaggacagcaagtcggag
aatggggagaatgcacccatctactgcatctgccgcaagccggacatcaactgcttcatg
atcggctgtgacaactgcaatgagtggttccatggggactgcattcggatcactgagaag
atggccaaggccatccgggagtggtactgtcgggactgccgagagaaagacccgaagttg
gagattcgctatcggcataagaagtctcgggagcgggacggcagtgagcgggacggcagt
gagccccgggatgagggtggcgggcgcaagaggcctatcccggatccggacctgcagcgc
cgggcagggtcaggaacaggggttggggccatgcttgctcggggctctgcttcgccccac
aaatcctctccacagcccttgatggtcatacccagccagnntcaccagcagcagcagcag
atcaaacggtcagcccgcatgtgtggtgagtgtgaggcctgccggcgcactgaagactgt
ggccactgtgacttctgccgggacatgaagaagtttgggggccccaacaagatccggcag
aagtgtcggctacgccagtgccagctgcgggcccgggaatcgtacaagtacttcccttcc
tcgctctcgccggtgacgccctcagagtccctgccaaggccccgccggccactgcctacc
cagcagcagccacagccatcacagaagctggggcggatccgggaagatgagggggcagtg
gcatcagcagcagtcaaggagccgcccgaggctacagccacgcccgagccactgtccgac
gaggacttgccactggaccctgacctctaccaggacttctgtgcgggggcctttgatgac
catggcctgccttggatgagtgacacggaagagtccccgtttctggaccccgcgttgcgg
aagagagccgtgaaggtgaagcatgtgaagcgccgggaaaagaagtctgagaagaagaag
gaagagagatacaagcggcaccggcagaagcagaagcacaaggacaaatggaaacaccca
gagagggctgacgccaaggaccctgcatcactgccacagtgcctggggcctggctgtgtg
cgcgctgcccagcccggctccaagtattgctcggatgactgcggcatgaagctggcagcc
aaccgcatctacgagatcctcccgcagcgcatccagcagtggcagcagagcccctgcatc
gcggaggagcatggcaagaagctgctagagcgcatccgccgggagcagcagagcgcccgc
acccgcctccaggaaatggagcgccgcttccatgagctcgaggccatcattctgcgtgcc
aagcagcaggctgtgcgcgaggatgaagagagcaatgagaatgacagcgacgacacagac
ctgcagatcttctgcgtttcctgcgggcatcccatcaacccacgcgttgccttgcgccac
atggagcgctgctatgccaagtatgagagccagacgtccttcgggtccatgtaccccacc
cgcattgaaggggccacacgactcttctgtgatgtatacaaccctcagagcaaaacatac
tgtaagcggctccaggtgctgtgtcctgagcactcgcgggaccccaaagtgccagccgac
gaggtgtgcgggtgtcctcttgtgcgggatgtctttgagctcacaggtgacttctgccgc
ctgcccaagcgccagtgcaatcgtcattactgctgggagaagctgcggcgagccgaagtg
gacctggagcgcgtgcgcgtgtggtacaagttggacgagctgtttgagcaggagcgcaac
gtgcgcacagccatgacaaaccgcgcagggctgctggccttgatgctgcaccagacaatc
cagcacgacccgctcaccaccgacctgcgctccagcgccgaccgctga

DBGET integrated database retrieval system