KEGG   Oryctolagus cuniculus (rabbit): 103349392
Entry
103349392         CDS       T03373                                 

Gene name
PMAIP1
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103349392 (PMAIP1)
   04215 Apoptosis - multiple species
    103349392 (PMAIP1)
   04115 p53 signaling pathway
    103349392 (PMAIP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103349392 (PMAIP1)
   05203 Viral carcinogenesis
    103349392 (PMAIP1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103349392 (PMAIP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103349392 (PMAIP1)
SSDB
Motif
Pfam: PMAIP1
Other DBs
NCBI-GeneID: 103349392
NCBI-ProteinID: XP_008259644
LinkDB
Position
9
AA seq 103 aa
MPGKRARKRSQSSPKRAPAELEGGCGAQLPGTGLPLPVSAEFSAVALAEKSGKKAQKNAQ
PRPARPLSELEVECATQLRIIGDKLDLRRKLLNLISKFFNFVP
NT seq 312 nt   +upstreamnt  +downstreamnt
atgcccgggaagagggcgcgcaagagatctcaatcgagtccgaagcgagcgccagcagag
ctggaaggtggctgtggcgctcagctccccggaacgggactgcccctccccgtatctgcg
gagttttcagctgtggccctggcggagaagtctgggaagaaggcacagaagaatgcccag
ccaaggccggcgcgccctctgtcggagctggaagtcgaatgtgccactcaactcaggatc
atcggagataaactggatttgcgcagaaaactactgaatctcatatctaagttcttcaac
ttcgtcccctga

DBGET integrated database retrieval system