KEGG   Oryctolagus cuniculus (rabbit): 103349397
Entry
103349397         CDS       T03373                                 

Gene name
BCL2
Definition
(RefSeq) BCL2, apoptosis regulator
  KO
K02161  apoptosis regulator Bcl-2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu01524  Platinum drug resistance
ocu04064  NF-kappa B signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04115  p53 signaling pathway
ocu04140  Autophagy - animal
ocu04141  Protein processing in endoplasmic reticulum
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04217  Necroptosis
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04340  Hedgehog signaling pathway
ocu04510  Focal adhesion
ocu04621  NOD-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04725  Cholinergic synapse
ocu04915  Estrogen signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05014  Amyotrophic lateral sclerosis
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05162  Measles
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05215  Prostate cancer
ocu05222  Small cell lung cancer
ocu05226  Gastric cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103349397 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    103349397 (BCL2)
   04630 JAK-STAT signaling pathway
    103349397 (BCL2)
   04064 NF-kappa B signaling pathway
    103349397 (BCL2)
   04066 HIF-1 signaling pathway
    103349397 (BCL2)
   04071 Sphingolipid signaling pathway
    103349397 (BCL2)
   04151 PI3K-Akt signaling pathway
    103349397 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103349397 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    103349397 (BCL2)
   04215 Apoptosis - multiple species
    103349397 (BCL2)
   04217 Necroptosis
    103349397 (BCL2)
   04115 p53 signaling pathway
    103349397 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103349397 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103349397 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103349397 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    103349397 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103349397 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    103349397 (BCL2)
   04722 Neurotrophin signaling pathway
    103349397 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103349397 (BCL2)
   05206 MicroRNAs in cancer
    103349397 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103349397 (BCL2)
   05226 Gastric cancer
    103349397 (BCL2)
   05215 Prostate cancer
    103349397 (BCL2)
   05222 Small cell lung cancer
    103349397 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103349397 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    103349397 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103349397 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103349397 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103349397 (BCL2)
   05152 Tuberculosis
    103349397 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103349397 (BCL2)
   05161 Hepatitis B
    103349397 (BCL2)
   05162 Measles
    103349397 (BCL2)
   05168 Herpes simplex virus 1 infection
    103349397 (BCL2)
   05169 Epstein-Barr virus infection
    103349397 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103349397 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103349397 (BCL2)
   01524 Platinum drug resistance
    103349397 (BCL2)
   01522 Endocrine resistance
    103349397 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    103349397 (BCL2)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103349397 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 103349397
NCBI-ProteinID: XP_008259661
Ensembl: ENSOCUG00000025312
UniProt: G1TW27
LinkDB
Position
9
AA seq 226 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASAPGVFSSQPAPAAPRDPAART
SPPPPPAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFHARGRFATV
VEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNG
GWDAFVELYGPSVRPLSDFSWVSLKTLFSLALIGACITLGAYLGHK
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcgcacgccgggcgaacagggtacgacaaccgggagatcgtgatgaagtacatccac
tataagctgtcccagaggggctacgagtgggacgctggggacgcgggcgccgcctccgcg
ccgggcgtcttctcctcccagcccgcgcccgctgcgccccgggacccggccgccaggacc
tcgccgccgccgccgccggccgccgcggggcccgcgctcagcccggtgccacctgtggtc
cacctgaccctccgccaggcgggcgacgacttctcccggcgctaccgccgcgacttcgcg
gagatgtccagccagctgcacctgacgccctttcacgcgagggggcgctttgccacggtg
gtggaggagctcttcagggatggggtgaactgggggaggattgtggccttctttgagttc
ggtggggtcatgtgtgtggagagcgtcaaccgggagatgtcgcccctggtggacaacatc
gccctgtggatgactgagtacctgaaccggcacctgcacacctggatccaggataatgga
ggctgggatgccttcgtggaactgtacggccccagcgtgcggcctctgtcagacttctcc
tgggtgtctctgaagactttgttcagcctggccctgataggagcttgcatcaccctcggt
gcctacctgggccacaagtga

DBGET integrated database retrieval system