KEGG   Oryctolagus cuniculus (rabbit): 103350044
Entry
103350044         CDS       T03373                                 

Gene name
FDPS
Definition
(RefSeq) farnesyl diphosphate synthase
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00900  Terpenoid backbone biosynthesis
ocu01100  Metabolic pathways
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
Module
ocu_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    103350044 (FDPS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103350044 (FDPS)
   05164 Influenza A
    103350044 (FDPS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ocu01006]
    103350044 (FDPS)
Enzymes [BR:ocu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     103350044 (FDPS)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     103350044 (FDPS)
Prenyltransferases [BR:ocu01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   103350044 (FDPS)
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-GeneID: 103350044
NCBI-ProteinID: XP_008262563
LinkDB
Position
13
AA seq 420 aa
MPLSRWLRSVGLLLLPAPCWVPRERLLGSLRRPSLVHGYPVLGAWHSARCWCQARTEEPR
ALCSSLIMNGDQKPDAYAQEKQDFIQHFSQIVRVLTEEEMGHPETGDAIARLKEVLEYNA
IGGKYNRGLTVLVAFRELVEPRKQDAESLQRALTVGWCVELLQAFFLVSDDIMDSSLTRR
GQPCWYQKPGIGLDAVNDALLLEACIYRLLKFYCREQPYYLNLIELFLQSSYQTEIGQTL
DLITAPQGSVDLSRYTEKRYKSIVKYKTAFYSFYLPVAAAMYMAGIDGEKEHANAKKILL
EMGEFFQIQDDYLDLFGDPSVTGKVGTDIQDNKCSWLVVQCLQRATPEQRQILQENYGQK
EAEKVARVKALYEELDLPAVFSQYEEDSYGHLMGLIEQYAAPLPASIFLGLARKIYKRKK
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgcccttgtcccgctggctgagatctgtggggctcctcctgctgccagctccctgctgg
gtgccccgggagaggttgctgggttccctacggaggccctctctggtgcacgggtacccg
gtcctgggggcctggcacagtgcccgatgctggtgccaagcgaggacagaggagccccga
gcactttgctcctctctcataatgaacggagaccagaagccagatgcttacgcccaagag
aagcaggacttcatccagcacttctcgcagatcgtcagggtgctgaccgaggaggagatg
gggcacccggagacgggcgacgctattgcccgtcttaaggaggtcctggagtacaatgcc
attggcggcaagtacaaccggggtttgacggtgctggtggccttccgggagctggtggag
ccacggaagcaggacgctgagagtctccagcgggccctgaccgtgggctggtgtgtggaa
ctgctgcaagctttcttcctggtgtcagatgacatcatggattcttccctcacccgccgg
gggcagccctgctggtatcagaagccaggcataggtttggacgccgtcaacgatgccctg
cttctggaagcgtgcatctaccgcctgctcaagttctactgtcgggagcagccctactac
ctgaacctcatcgagctcttcctacagagttcttaccagactgagattgggcaaaccctg
gacctcatcacagcgccccagggcagtgtggacctaagcagatacactgaaaagaggtac
aaatccatcgtcaagtacaagacagccttctactccttctacctccccgtggccgcggcc
atgtacatggcaggcattgacggggagaaggaacacgcgaatgccaagaagatcctgctg
gagatgggggagttctttcagattcaggatgattacctcgacctctttggggaccccagt
gtgaccggcaaggttggcaccgacatccaggacaacaagtgcagctggctggtggtccag
tgtctgcagcgggccaccccggaacagcgtcagatcctgcaggagaattatgggcagaag
gaggccgagaaggtggcccgggtgaaggcactgtacgaggagctggatctgccggccgtg
ttctcgcagtacgaggaggacagctacggccacctcatgggtctcatcgagcagtacgct
gcgcccctacccgcgtccatcttcctggggctagcgcgcaagatatacaagcggaaaaag
tga

DBGET integrated database retrieval system