KEGG   Oryctolagus cuniculus (rabbit): 103350153
Entry
103350153         CDS       T03373                                 

Gene name
GNG12
Definition
(RefSeq) G protein subunit gamma 12
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04062  Chemokine signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04371  Apelin signaling pathway
ocu04713  Circadian entrainment
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04727  GABAergic synapse
ocu04728  Dopaminergic synapse
ocu04810  Regulation of actin cytoskeleton
ocu04926  Relaxin signaling pathway
ocu05032  Morphine addiction
ocu05034  Alcoholism
ocu05163  Human cytomegalovirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103350153 (GNG12)
   04014 Ras signaling pathway
    103350153 (GNG12)
   04371 Apelin signaling pathway
    103350153 (GNG12)
   04151 PI3K-Akt signaling pathway
    103350153 (GNG12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103350153 (GNG12)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103350153 (GNG12)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103350153 (GNG12)
  09156 Nervous system
   04724 Glutamatergic synapse
    103350153 (GNG12)
   04727 GABAergic synapse
    103350153 (GNG12)
   04725 Cholinergic synapse
    103350153 (GNG12)
   04728 Dopaminergic synapse
    103350153 (GNG12)
   04726 Serotonergic synapse
    103350153 (GNG12)
   04723 Retrograde endocannabinoid signaling
    103350153 (GNG12)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103350153 (GNG12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103350153 (GNG12)
  09165 Substance dependence
   05032 Morphine addiction
    103350153 (GNG12)
   05034 Alcoholism
    103350153 (GNG12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103350153 (GNG12)
   05163 Human cytomegalovirus infection
    103350153 (GNG12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103350153 (GNG12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    103350153 (GNG12)
   04031 GTP-binding proteins [BR:ocu04031]
    103350153 (GNG12)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103350153 (GNG12)
  Exosomal proteins of colorectal cancer cells
   103350153 (GNG12)
GTP-binding proteins [BR:ocu04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    103350153 (GNG12)
SSDB
Motif
Pfam: G-gamma CP12
Other DBs
NCBI-GeneID: 103350153
NCBI-ProteinID: XP_017201671
Ensembl: ENSOCUG00000024324
UniProt: G1TUD2
LinkDB
Position
13
AA seq 72 aa
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCIIL
NT seq 219 nt   +upstreamnt  +downstreamnt
atgtccagcaaaacagcaagcaccaacaacatagcccaggcaaggaggactgtgcagcag
ctacgattagaagcctccattgaaagaataaaggtttcaaaggcatcagcagacctcatg
tcctactgtgaggagcacgccaggagtgaccctttgctgataggaatcccaacctcagaa
aaccctttcaaggataaaaaaacgtgcatcatcttatag

DBGET integrated database retrieval system