KEGG   Oryctolagus cuniculus (rabbit): 103351829
Entry
103351829         CDS       T03373                                 

Definition
(RefSeq) CXXC-type zinc finger protein 1
  KO
K14960  COMPASS component SPP1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    103351829
   03036 Chromosome and associated proteins [BR:ocu03036]
    103351829
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Zinc finger
   CXXC CpG-binding proteins
    103351829
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    COMPASS/SET1 complex
     103351829
    COMPASS/SET1 complex (yeast)
     103351829
SSDB
Motif
Pfam: CpG_bind_C
Other DBs
NCBI-GeneID: 103351829
NCBI-ProteinID: XP_008270859
LinkDB
Position
X
AA seq 306 aa
MGRGWSRKLLQQFFFPVHCTSVEIFRNSFEELRGNFCLASLATAHFTAALTTGVQKNMQK
QKHTHKKKHKEHTDPAASTPLQQCLGPRCVYAARPGSKYCSDDCGMKLAAERIYEILPQR
IQQWQNSPCVAQEINQKMLEQIDHEKQVTHSHLKHMEHHLYELEAIILRGKQQTVCVDEE
CDVYNPESKRYCKRLQVLCPEHTRDPKVSKDEVCGCPLVSNVFEFTGDFCRLPKHLCNRH
YCWEKLRRAEVDLERVRALHKLEQLFEQEQKVRMAMTNRAGLLGLMLHQTIQHDPLTSDL
RSRADS
NT seq 921 nt   +upstreamnt  +downstreamnt
atggggcggggctggagccggaagttactgcagcagttttttttccccgtgcactgtacg
agcgttgagatatttcggaactcctttgaagagctgcgcggaaacttctgtctggcctcg
ctggccactgcccacttcacagctgccttaaccacaggagtccagaagaatatgcagaag
cagaagcacacacacaagaagaaacacaaagagcacacagatcctgcggcctcaactcca
ctgcagcagtgcttggggcctcgctgtgtgtatgctgcccgtccaggctcgaagtactgc
tcggatgattgcggcatgaagcttgcagctgaacgcatctatgagatcttgccccagcgc
atccagcagtggcagaacagcccctgcgtcgctcaggagatcaaccaaaaaatgttggag
caaatcgatcacgagaagcaggtcacccatagccacctgaagcacatggaacaccattta
tatgaacttgaggccatcatcctgcgtggcaagcagcagactgtgtgtgtggacgaggag
tgtgatgtctacaacccagagagtaagaggtactgtaagcggctccaggtgctgtgcccc
gagcacactcgggaccccaaggtgtccaaagacgaggtgtgtggttgcccgctagtgagc
aatgtctttgagttcacaggtgatttctgtcgccttcccaaacacctgtgcaaccgccac
tactgctgggagaagctgaggcgcgccgaggtggacctggaacgcgtgcgggcgttgcac
aagctggaacagctgttcgaacaagagcaaaaggtgcgcatggctatgaccaatcgggca
ggactcctggggctgatgcttcaccagaccattcagcacgatccgctcacctctgacctg
cgctcccgggcggacagctga

DBGET integrated database retrieval system