KEGG   Oryctolagus cuniculus (rabbit): 108175387Help
Entry
108175387         CDS       T03373                                 

Gene name
ERCC5
Definition
(RefSeq) ERCC excision repair 5, endonuclease
  KO
K10846  DNA excision repair protein ERCC-5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    108175387 (ERCC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    108175387 (ERCC5)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     108175387 (ERCC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 108175387
NCBI-ProteinID: XP_008258387
LinkDB All DBs
Position
8
AA seq 1194 aa AA seqDB search
MGVQGLWKLLECSGRQVSPETLEGKILAVDISIWLNQALKGVRDRHGNSIENAHLLTLFH
RLCKLLFFRIRPIFVFDGDAPLLKKQTLAKRRQRKDLASTDSRKTTEKLLKTFLKRQALK
TAFKSKRNEALPSLTQVQREDDIYVLPPLKEEEKHSSEEEDEKEWQERMSQKQALQEEFF
HNPHAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESNDFSQYQLKGLLKK
NYLNQHIENVQKEMNQQHSGQIQKQYEEEGGFLREVESRRVVSEDTSHYILIKGIQAKKV
AEVDSESLPSSSKVHSVSLDMKSSPCEKLKPEKEPDATPPSPRTLLALQAAMLGSSSDEE
LESGSLSQHRERKVSAAGDDGSISPRTLSAIQRALDEDEDVKMCAGDSVQGAGPGVTKLP
VKSSKEEKDEGLEVRDKKGVLSTAVQPSASVTFVEECVASTESERELPGSAHLSTAVCSE
GSESDAPKEQKSFVPVVNEAFQTSDGSAVKDRRDPLPSENTVVLPSDAPGLPTLVAPAST
GSVSRNGTPAKELELQKDLSPSERKFDSSILSSDEETKCEQNPVSEVIGAVSSPEVSDLI
SVPSEVIGHSKDAESLNAEENDNFLKILQQQETVGSPGPGSISFPKSVEPGAIDSDESES
DGSFIEVQGGISEDEVQTESNEASRPPSEQGDMVPMGAKDEEATGDTESLPRDHSESKDL
DIEPHEEHEKDTEDSFNEWQDIDLEELETLENDLLAQQNSLKAQKQQQERVAATVTGQMF
LESQELLRLFGIPYVEAPMEAEAQCAILDLTDQTSGTITDDSDIWLFGARHVYKNFFNKN
KFVEYYQYVDFHNQLGLDRNKLINLAYLLGSDYTEGIPTVGCVTAMEILNEFPGHGLEPL
VKFSEWWQEAQKNQKIRPNPHDTKVKKKLRKLQLAPGFPNPAVAEAYLKPVVDDSKGAFL
WGKPDPDKIREFCQRYFGWNRSKTDESLLPVLKQLNVQQTQLRIDSFFRLAQQEKQEAKR
IKSQRLNRAVTCMLRKEREEVASELEAVSVAMEKEFEMLDKAEGASQKRSTARKLEEPSS
LKRKRLSASAHESQAGGFLGDAYLSESSDTCSGEDAERLSPVSTQRKTAKESTCSPSAWQ
SSARDARARDGGATTCSSSDGDGEEAGTVLVTARPVFGKKRRRLRSARGRKRKT
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atgggggtccaggggctgtggaagctgctggagtgctccgggcggcaggtcagccccgag
acgctggaaggcaagatcctggctgtcgatattagtatttggttaaaccaggcacttaaa
ggagtccgagatcgccatgggaactccatagaaaatgctcatcttctcactttgtttcat
cgcctctgcaaactcttattttttcgaattcgtcctatttttgtgtttgatggggatgct
ccactactgaagaaacagactttggctaagaggaggcagagaaaggatttagcatctact
gattccaggaaaactacagaaaagcttctgaaaacatttttgaaaagacaagctctcaaa
actgccttcaaaagcaagagaaatgaagcactcccgagtctcactcaagttcaaagagaa
gatgacatctacgttttaccacctttgaaagaggaagaaaaacacagctcagaagaggaa
gatgaaaaagaatggcaagaaagaatgagtcaaaaacaagcattacaggaagaattcttt
cataaccctcatgcgatagatattgaatctgaggacttcagcagtctgccacctgaagta
aagcatgagatcttgactgatatgaaagaatttaccaaacgaagaagaacattatttgaa
gcaatgccagaggagtccaatgatttttcacaataccaactcaaaggcttgcttaaaaaa
aactacctaaaccagcacatagaaaatgtccaaaaggaaatgaaccagcaacactcaggg
caaatccaaaagcaatatgaagaggaagggggctttttgagggaggtagagtccaggaga
gtggtctctgaagacacctcacattacatcttgataaaaggcattcaagctaagaaagtt
gcagaagtggattcagagtctctgccttcttccagcaaagtgcacagtgtgtctcttgac
atgaagtcgtctccatgtgaaaagctgaagccggagaaggagcctgatgccacccctccc
tctccaaggactctgctggctctgcaggctgccatgctgggaagtagctcagatgaggag
ctggagagtggaagtctcagccagcaccgggagaggaaggtgtctgccgctggcgacgat
ggctccatatctccacgcactctgtcagctattcagagagcccttgatgaggatgaagac
gtgaaaatgtgtgctggggacagtgtgcagggagcaggaccaggagtgacaaaactgcct
gtaaagagttccaaagaggaaaaggacgaaggtcttgaagtgagagataaaaaaggagtg
ctgtctaccgctgtccagccttcagccagtgtgacctttgtagaggagtgcgtagccagc
actgaaagtgagcgagagctgccaggctcagctcatttgtcaactgctgtctgttctgaa
ggcagcgagtctgatgctccaaaagaacaaaaatcattcgttcctgtggtgaacgaagct
tttcagacaagtgatgggtctgcagttaaggatagaagagatccacttccttcagagaac
acagtggttctgcccagtgatgcgcctgggctcccgaccctggtggctccagcaagcaca
ggatctgtatccaggaatgggacacctgccaaagaactggagctgcagaaagatctctcc
ccatctgagaggaaatttgattcctctattctttctagtgatgaagaaacaaaatgtgaa
caaaatcctgtgtctgaagtcattggcgctgtcagttcaccagaagtgagtgacctaata
agtgtgccttcagaggtgataggtcactcaaaagatgcagaatcacttaatgcagaagag
aatgacaatttcctaaaaatcctccaacaacaggagacagttggatctccaggcccgggt
tccatttcgttccccaagtccgtggaaccaggggctatcgactctgacgagagtgaatct
gatggaagtttcattgaagtgcagggtgggatcagtgaggacgaagttcaaactgaatcg
aatgaagcttccaggcctccctctgaacaaggggacatggtgccaatgggagctaaggat
gaagaagccactggggataccgagagcctcccaagggaccactctgaaagcaaggacttg
gatattgagccccatgaagaacatgaaaaggatacagaagattccttcaatgaatggcaa
gatattgatttggaagagctggaaactctggagaacgacctcttagcgcagcagaattca
ctgaaggctcagaagcagcagcaagaacgggtcgctgccactgtcacaggacagatgttt
ctggaaagccaggaactcctgcgcctgttcggcattccctacgtggaggcgcccatggag
gccgaggcgcagtgcgccatcctggacctcacggaccagacttccggaaccatcaccgac
gacagtgatatctggctgttcggagcgcggcacgtctacaaaaacttttttaataaaaac
aagtttgtagaatattaccagtatgtggacttccacaaccaattaggattggaccggaac
aaattaataaatttggcctatttgcttgggagtgattacacggaagggataccaactgtg
ggttgtgtaacagccatggaaattctcaatgaattccctgggcatggcctggaacctctt
gtcaaattttcagagtggtggcaggaggctcaaaaaaatcagaagataaggcctaacccc
catgacaccaaagtgaaaaaaaagttacggaagttgcaactcgcccctggttttccgaac
cctgctgtggcggaagcttacctgaaacctgtggtggatgactccaagggagccttcctg
tgggggaagcctgatccggacaagattcgggaattctgccagcggtacttcggttggaac
aggagtaagacggatgaatctctgcttccggttttaaagcaactgaatgtccagcagaca
cagctgcgaatcgactctttctttagattagcccaacaggagaagcaagaagccaaacgt
attaagagccagagattaaacagagctgtgacgtgtatgctgcggaaagaaagggaagaa
gtagccagtgagctagaagcagtctctgttgctatggagaaagaatttgagatgcttgat
aaggcagaaggagcaagccagaagagaagcacagcgaggaaactggaggagccgtcaagc
ctgaaaagaaagaggctttcagcttctgcccacgagagtcaggctggtggatttctgggg
gatgcctacctctcagagtcctctgacacctgttccggtgaggacgcggagcgtttatct
ccagtcagcacgcaaaggaaaacagcaaaggagtccacatgcagcccttcagcgtggcag
agctcggccagagatgcgcgtgcccgggacggaggtgccacgacctgcagctccagcgat
ggggacggagaggaggccgggaccgtcctggtgacagccaggcctgtgtttgggaagaag
aggaggaggctgagaagcgcacgggggaggaaaaggaaaacctga

DBGET integrated database retrieval system