KEGG   Oryctolagus cuniculus (rabbit): 108175645
Entry
108175645         CDS       T03373                                 

Definition
(RefSeq) uncharacterized LOC108175645
  KO
K10785  T-cell receptor beta chain V region
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05144  Malaria
ocu05150  Staphylococcus aureus infection
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05202  Transcriptional misregulation in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108175645
   04015 Rap1 signaling pathway
    108175645
   04064 NF-kappa B signaling pathway
    108175645
   04020 Calcium signaling pathway
    108175645
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108175645
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    108175645
   04660 T cell receptor signaling pathway
    108175645
   04658 Th1 and Th2 cell differentiation
    108175645
   04659 Th17 cell differentiation
    108175645
   04672 Intestinal immune network for IgA production
    108175645
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    108175645
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108175645
  09163 Immune disease
   05310 Asthma
    108175645
   05322 Systemic lupus erythematosus
    108175645
   05323 Rheumatoid arthritis
    108175645
   05320 Autoimmune thyroid disease
    108175645
   05321 Inflammatory bowel disease
    108175645
   05330 Allograft rejection
    108175645
   05332 Graft-versus-host disease
    108175645
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108175645
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108175645
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108175645
   05150 Staphylococcus aureus infection
    108175645
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108175645
   05170 Human immunodeficiency virus 1 infection
    108175645
   05162 Measles
    108175645
   05169 Epstein-Barr virus infection
    108175645
  09174 Infectious disease: parasitic
   05144 Malaria
    108175645
   05142 Chagas disease
    108175645
SSDB
Motif
Pfam: V-set Ig_3
Other DBs
NCBI-GeneID: 108175645
NCBI-ProteinID: XP_017193325
LinkDB
Position
Un
AA seq 241 aa
MVPQSGQADQNSALPNPEHKKRWAFYCCAMACWLLPWSLFCLLGAGPVEAGVTQTPRYLI
QTRGQQVSLTCTPDSGHNRVVWYQQVLGQGLQFLFDYYLGSQNAKGNVSGRFSAHQFSDF
SSEMNVSTLELQDSAVYLCASSLAQPRGVPSALCTNLLSQGGAASADTAEVPWVPDAAMG
SRLLCWVVLCLLGAALPPGEGQSQWLCFTIDLPSGTQGPGNLSEILQAWCARSLKLKHSQ
P
NT seq 726 nt   +upstreamnt  +downstreamnt
atggtcccccaatcaggacaagcagaccaaaactcagctcttcccaaccccgagcacaaa
aaacgttgggctttctactgctgtgccatggcgtgctggctcctcccctggtctctgttt
tgtctcctgggagcaggaccagtggaggcaggagtcacacagacgccaagatacctgatc
caaacaagagggcagcaagtgtcgctgacgtgtacccctgactctggacacaaccgtgtg
gtgtggtaccaacaggtcctgggccagggactccaattcctctttgattattacctaggg
tcacagaatgcaaaaggaaatgtctcgggcaggttctcagctcaccagttttctgacttt
agctctgaaatgaacgtgagcaccttggagctgcaggactcggctgtgtacctctgtgcc
agcagcttggcacagccccgcggagtccccagtgctctgtgcacaaacctcctctcccag
ggtggagcagcctcagctgacacagctgaggtgccttgggttcctgatgctgccatgggc
tccaggctgctctgctgggtggtcctgtgtctcctgggagcagccctgcccccgggtgaa
ggacaatctcagtggctgtgttttactatcgatctcccttctgggacccagggtccgggg
aacctgagcgagatcctccaagcatggtgtgcccgctcgctcaagctgaagcactcacag
ccctga

DBGET integrated database retrieval system