KEGG   Oryctolagus cuniculus (rabbit): 108176138
Entry
108176138         CDS       T03373                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10A-like
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04217  Necroptosis
ocu04650  Natural killer cell mediated cytotoxicity
ocu05132  Salmonella infection
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108176138
   04061 Viral protein interaction with cytokine and cytokine receptor
    108176138
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108176138
   04217 Necroptosis
    108176138
   04115 p53 signaling pathway
    108176138
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    108176138
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108176138
  09172 Infectious disease: viral
   05164 Influenza A
    108176138
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    108176138
   04090 CD molecules [BR:ocu04090]
    108176138
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   108176138
CD molecules [BR:ocu04090]
 Proteins
  108176138
SSDB
Motif
Pfam: TNFR_c6 Death DUF3149 DUF4381
Other DBs
NCBI-GeneID: 108176138
NCBI-ProteinID: XP_017195576
LinkDB
Position
Un
AA seq 414 aa
MIACEPDEYLVENYCCRFCPAGHFVSGLCSQNHSIGECEPCRPGTFMAYPSSEASCSPCS
PCRPDQEVVANCTLTSNTRCQCRPGHFYCDSEDCVENCFRCSRCPKDKVTRRLCTPTRNT
ECADPTTGWWLLSLLAIPFVLVLILFIVRYCKSRGRSLGQACWGAKGLAGLSSPVPGVLR
SLARIFKRKSSEPGSHALGPLEPTEALLSAETKGSEMDPGREDALLVMEEETSASAPGAG
PCPAPTGPGGSPEPQAAASGTSPTGPGQAPHPDPAARGARNRTKAAASLEELEQEYAEQY
VLMDTSGPGISACYYHFVREVPRDRWNMFMRFVGLQENEIASCEEENPKNVVEQHYRMLV
LWRDRQGSRATVFRLMAALQKLQEDMPLQNTLNKLVAERILGKRHGGDTPHAAS
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgattgcctgtgagcccgatgaatatctggttgaaaactactgctgtagattctgccca
gcgggccacttcgtcagcgggctgtgttcacagaaccacagcattggagagtgcgagccg
tgcaggcctgggacgttcatggcctaccccagcagtgaggcgtcctgctccccgtgcagc
ccctgccggcccgaccaggaggtggtggccaactgcactctgaccagcaacacccggtgc
cagtgccggccgggccacttctactgcgactctgaggactgcgtggaaaactgcttccgc
tgtagcaggtgccccaaggacaaggtcacccgcaggctgtgcactcccaccaggaacaca
gagtgtgccgaccccacgacagggtggtggctcctgagcttgctggccatcccgttcgtg
ctcgtgctcatcctgttcatcgttcgctactgcaaaagcagaggccggagtctcgggcag
gcgtgctggggagccaagggcctcgccggcctctcgtcccccgtcccgggtgtactgcgg
tcgctggccaggatcttcaaacgcaagtccagtgagccaggaagccatgcgctcgggccc
ctggagcccactgaggcgctgctgtccgcggagaccaagggcagcgagatggaccctggg
agggaagacgcgctgctggtgatggaggaggagacctcagcctcagcgcccggagccggg
ccctgccctgcacccacaggccctggggggagccccgagccgcaggcagcagcttctgga
acgagtcccacgggccctgggcaggcaccgcaccccgatcctgctgcccggggggcccgg
aaccggaccaaggcggcagcctccctggaggagctggagcaggagtatgcagagcagtac
gtcctgatggacacgtccggtcctggcatcagtgcgtgttactaccacttcgtgcgtgaa
gttccgagagacagatggaacatgtttatgcggtttgtcgggctccaggagaacgagatt
gccagttgtgaggaggagaaccccaagaacgtggtggagcagcactacaggatgctggtg
ctgtggcgggacagacagggcagccgcgcgacggtgttccggctcatggctgccctccag
aagctgcaggaggacatgcccctgcagaacaccctgaacaaactggtggctgagcgcatc
ctgggtaaacgccacggcggagacacgccacacgcagcctcgtga

DBGET integrated database retrieval system