KEGG   Oryctolagus cuniculus (rabbit): 108176185Help
Entry
108176185         CDS       T03373                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04062  Chemokine signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04371  Apelin signaling pathway
ocu04713  Circadian entrainment
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04727  GABAergic synapse
ocu04728  Dopaminergic synapse
ocu04810  Regulation of actin cytoskeleton
ocu04926  Relaxin signaling pathway
ocu05032  Morphine addiction
ocu05034  Alcoholism
ocu05163  Human cytomegalovirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108176185
   04010 MAPK signaling pathway
    108176185
   04371 Apelin signaling pathway
    108176185
   04151 PI3K-Akt signaling pathway
    108176185
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108176185
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    108176185
  09152 Endocrine system
   04926 Relaxin signaling pathway
    108176185
  09156 Nervous system
   04724 Glutamatergic synapse
    108176185
   04727 GABAergic synapse
    108176185
   04725 Cholinergic synapse
    108176185
   04728 Dopaminergic synapse
    108176185
   04726 Serotonergic synapse
    108176185
   04723 Retrograde endocannabinoid signaling
    108176185
  09159 Environmental adaptation
   04713 Circadian entrainment
    108176185
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    108176185
  09164 Substance dependence
   05032 Morphine addiction
    108176185
   05034 Alcoholism
    108176185
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    108176185
   05167 Kaposi sarcoma-associated herpesvirus infection
    108176185
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    108176185
   04031 GTP-binding proteins [BR:ocu04031]
    108176185
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108176185
  Exosomal proteins of colorectal cancer cells
   108176185
GTP-binding proteins [BR:ocu04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    108176185
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 108176185
NCBI-ProteinID: XP_017195731
Ensembl: ENSOCUG00000024063
UniProt: G1TJ50
LinkDB All DBs
Position
Un
AA seq 72 aa AA seqDB search
MSGKVAIGSDIGQARRAVEQLRMEAGIDRVKVSKAAADLLQFCTEQAKSDLFLVGIPAAT
NPFKEKKPCAIL
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcaaggtagccatcggcagcgacatcgggcaagcccgccgggcagtggagcag
ctacggatggaggccggcattgaccgtgtgaaggtgtccaaggcggccgctgacctactg
cagttctgcacggagcaggccaagagcgacctcttccttgtgggcatcccggccgccacc
aaccccttcaaggagaagaagccctgtgccatcctgtga

DBGET integrated database retrieval system