KEGG   Oryctolagus cuniculus (rabbit): 108178030
Entry
108178030         CDS       T03373                                 

Gene name
XPA
Definition
(RefSeq) XPA, DNA damage recognition and repair factor
  KO
K10847  DNA-repair protein complementing XP-A cells
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    108178030 (XPA)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108178030 (XPA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    108178030 (XPA)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     108178030 (XPA)
SSDB
Motif
Pfam: XPA_C XPA_N Zn-ribbon_8 zf_C2H2_13 zf-dskA_traR
Other DBs
NCBI-GeneID: 108178030
NCBI-ProteinID: XP_017202734
LinkDB
Position
1
AA seq 298 aa
MEETARLRDTSITPKCICLRSHSRPDNGGSRELFAGAGRLPNNPRSCLLRCRASIERKRQ
RALMLRQARLAARPYPATAGAATGGVANVKAPKIIDTGGGFILEEEEEEHKVGNIVHQPG
PVLEFDYAICEECGKEFMDSYLMSHFDLATCDNCRDADDKHKLITKTEAKQEYLLKDCDL
EKREPALKFIVKKNPHHSQWGDMKLYLKLQVVKRSLEVWGSQDALEAAKEVRQENREKMK
QKKFDKKVRELRRAVRSSVWKRETTAHQHEYGPEENIDDDMYRKCCTVCGHELTYEKM
NT seq 897 nt   +upstreamnt  +downstreamnt
atggaagagacagcccgcctccgggacaccagcatcactcccaagtgcatctgcctgagg
tcacacagcaggcccgacaatggcggcagcagagagctcttcgctggagccgggcgactt
ccgaacaacccgcggagctgcctgcttcggtgccgggcgagcatcgagcggaagcggcag
cgggcgcttatgctgcgccaggcccggctggcggcccggccctacccggcgacggcgggc
gcggctaccggaggcgtggctaatgtgaaagcccccaagataatcgacacaggaggaggc
ttcattctggaagaggaagaggaggagcataaagtaggaaacattgtgcatcagccaggg
ccggtcctggagtttgactatgccatatgtgaagagtgtgggaaggagtttatggactcg
tacctcatgagccactttgacttggccacctgtgataactgcagagatgctgatgataaa
cacaagcttataaccaaaacagaggcaaaacaagaataccttctgaaagactgcgatttg
gaaaaaagagaaccagctcttaaatttatcgtgaagaagaatcctcatcattcgcagtgg
ggtgatatgaaactctacttaaaactacaggtcgtgaagaggtcccttgaagtctggggc
agtcaggatgcactggaagcagccaaggaagttcgacaggaaaaccgggaaaaaatgaaa
cagaagaagtttgataaaaaagtcagagaattgcggcgagcagtgagaagcagtgtgtgg
aaaagggaaacaactgctcaccaacacgagtatggacctgaggaaaacatagacgacgac
atgtaccggaagtgctgtaccgtgtgtggccatgaactgacatacgaaaaaatgtga

DBGET integrated database retrieval system