KEGG   Orrella dioscoreae: ODI_R3911Help
Entry
ODI_R3911         CDS       T05133                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
odi  Orrella dioscoreae
Brite
KEGG Orthology (KO) [BR:odi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ODI_R3911
Enzymes [BR:odi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ODI_R3911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored Glutaredoxin DAO K_oxygenase Thi4 NAD_binding_8 FAD_binding_3 AlaDh_PNT_C HTH_43 FMO-like
Motif
Other DBs
NCBI-ProteinID: SOE52088
UniProt: A0A1C3K2R8
LinkDB All DBs
Position
I:4276363..4277955
Genome map
AA seq 530 aa AA seqDB search
MLDASLKTQLKAYLERLTQDIEIVADLDDSPKSQETLGLLQDIDGLSDKVTLVVRHEDTG
VRRPSFSIGRPGAEAGIRFAGLPMGHEFTSLVLALLHTGGHPSKTAQDVIEQVRALDVPL
SFETYFSLSCQNCPDVVQALNLMAVLNPNVKHVAIDGALFQEEVDKRQIMSVPTIYLNGE
PFGQGRMGLEEILAKVDTGAASREAAKLNAKAPFDVLVVGGGPAGAAAAIYAARKGIRTG
VAAERFGGQVLDTMSIENFISVKETEGPKLAVALEEHVRQYDVDIMNLQRAESLKTTPEG
VEIGFAGGATLRGKTVIIATGARWREMNVPGEAQYRNKGVAYCPHCDGPLFKGKRVAVVG
GGNSGVEAAIDLAGVVSHVTLLEFAPELKADAVLVRKLRSLPNVDIITQAQTTEVTGDGS
RVNGLVYTDRASGQSKTVALEGVFVQIGLVPNSAWLKDSGVALTRFGEIEVDARGETSVP
GVFAAGDVTTVPYKQIVIAMGEGSKASLAAFDHLIRHSAPAEAPAEAATA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccagcctgaagacccagctcaaagcctacctggaacgtctcacccaagac
atcgagatcgtcgccgacctggacgacagcccgaagtcgcaggagaccctcggcctgctg
caggacatcgacggcctgtccgacaaggtcacgctggtcgtgcgccatgaagacaccggc
gtgcgccgcccctcgttctccatcggccgccccggcgccgaagcgggcatccgcttcgcc
ggcctgcccatgggccacgaattcacctcgctggtgctggccctgctgcacaccggcggc
catccttcgaagaccgcccaggacgtgatcgaacaggtccgcgccctggacgtgccgctc
agtttcgagacctatttctcgctgtcgtgccagaactgcccggacgtcgtgcaggcgctg
aacctgatggccgtgctgaaccccaacgtgaagcacgtcgccatcgacggcgcgctgttc
caggaagaagtggacaagcgccagatcatgtcggtgcccaccatctacctgaacggtgag
cctttcggccagggccgcatgggcctggaagaaatcctggccaaggtcgacaccggcgcc
gcttctcgtgaagccgccaagctcaacgccaaggcgcccttcgacgtgctggtcgtgggc
ggtggccccgccggcgccgccgcggccatctatgccgcccgcaagggcatccgcaccggc
gtcgccgccgagcgcttcggcggccaggtgctggacacgatgtccatcgagaacttcatt
tccgtcaaggaaaccgaagggccgaagctggctgtcgcgcttgaagagcacgtgcgccag
tacgacgtggacatcatgaacctgcagcgcgccgaaagcctgaagaccacgcccgaaggc
gtcgagatcggcttcgccggcggcgccacgctgcgcggcaagaccgtcatcatcgccacc
ggcgcccgctggcgcgaaatgaacgtgcccggcgaagcccagtaccgcaacaagggcgtg
gcctattgcccccactgcgacggccccctcttcaagggcaagcgcgtggccgtggtgggc
ggcggcaactcgggcgtcgaagccgccatcgacctggccggcgtcgtctcgcacgtcacg
ctgctggagttcgcaccggaactgaaggccgacgccgtgctggtgcgcaagctgcgcagc
ctgcccaacgtcgacatcatcacgcaggcgcagaccaccgaagtgaccggtgacggcagc
cgcgtgaatggcctggtctacaccgaccgcgcatcgggccagagcaagaccgtcgcgctg
gaaggcgtcttcgtccagatcggcctggtgcccaacagcgcctggctgaaggacagcggc
gtggccctgacccgcttcggcgagatcgaggtcgatgcccgcggcgaaacctcggtgccc
ggcgtgttcgccgccggtgacgtgacgaccgtgccctacaagcagatcgtcattgcgatg
ggcgaaggttccaaggcatcgctggccgccttcgaccacctgatccgccacagcgcaccg
gcggaagcgcccgccgaggccgcgacggcctaa

DBGET integrated database retrieval system