KEGG   Orrella dioscoreae: ODI_R4157Help
Entry
ODI_R4157         CDS       T05133                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
odi  Orrella dioscoreae
Pathway
odi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:odi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    ODI_R4157
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:odi03400]
    ODI_R4157
Enzymes [BR:odi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ODI_R4157
DNA repair and recombination proteins [BR:odi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ODI_R4157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S VirE1
Motif
Other DBs
NCBI-ProteinID: SOE52408
UniProt: A0A1C3K5M0
LinkDB All DBs
Position
I:complement(4558968..4561442)
Genome map
AA seq 824 aa AA seqDB search
MADTLKAYRAKRDFTLTAEPADGGQANPDARAFVIQKHWASRLHYDLRLELDGAMKSWAV
PKGPSYDPSVKRMAVQVEDHPIAYNQFEGDIPKGQYGAGKVIIWDEGTWAPVGDPRAGYR
KGHLKFALHGRKMQGGWALVRMKGKGEKQPPWLLIKEKDALARAEDDFSVVEAFPDSVVP
LRQAAGSGALPGVAADLPGALSPQLATLADAVPGSRSEWLYEIKFDGYRILARVEGEDVR
LYTRNGHDWTARMPRLAKTLARLDARSAWIDGEVVVLAENGAPSFQVLQNAFDSERTADI
VFYAFDLPYLGGRDLRGEPLSVRRHWLEKLMARSRDDHLRFSEAFDAAPSQLAATACKMG
LEGIIAKRQSSRYVSRRSPDWLKIKCARRQEFVVVGYTAPKGGRSGFGALLLAVHDAQGG
LRYAGRVGSGFDAAGLARMKQQLDALRATAPPLQGPTGAGGGITWVAPQLVVEVSFGEWT
SSGHVRQAVFRGVREDKPAQSITKEAPMAAKRAKAVAKKTVPARRRIRGAAPEGEAKLGK
LTHPERVIDPSTGLTKLDLARYYGQVATLILPQLKNRPVSFLRAPQGIHEEQFFQKHKEA
RIPGVRDLPRSLDPDHAPLMEVSTPQALLSAVQMNVVEFHTWNASKTVIGKPDRLLFDLD
PGKGVAWLAVKEGAALLRSLLEEIGLRAWLKTSGGKGLHVVVPLRRQYEWGTVKDFSAEI
VRHLARTIPQRFVAKSGPRNREGKIFVDYLRNGFGATTVAAWSARARPGLGVSVPIGWDE
LDSLESSAQWTIADIAARLEVGNAPWSDYAPQAIGRAMKAMGMA
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atggccgatacgctcaaggcctatcgcgccaaacgtgatttcacgttgaccgccgagccc
gccgacggcggccaggcgaaccccgatgcgcgggctttcgtcatccagaaacactgggcc
agccggctgcactatgacctgcgcctggaactggatggcgccatgaagagctgggcggtg
cccaagggccccagctacgacccgtcggtcaagcgcatggccgtgcaggtcgaggaccat
cccattgcctataaccagttcgaaggcgacatccccaagggccagtacggcgcgggcaag
gtcatcatctgggacgaaggcacgtgggcacccgtgggcgatccccgtgccggttatcgc
aaggggcacctgaagttcgcgctgcacggcaggaagatgcagggcggctgggcactggtg
cgcatgaagggcaagggcgagaagcagccgccgtggctgctcatcaaggagaaggacgcg
ctggcgcgtgccgaggacgacttcagcgtggtggaggcattcccggacagcgtggtgcca
ttgcgccaggccgcgggctcgggtgcgcttcccggcgttgcggcggacctgcccggcgcg
ctgtcgccgcaactcgccaccctcgccgacgccgtgccgggctcgcggagcgagtggctg
tacgagatcaagttcgacggctaccgcatcctggcaagggtggaaggagaggacgtccgg
ctctacacccgcaacgggcacgactggacggcgcgcatgccgcggctggccaagaccttg
gcgcggctggatgcgcggtccgcgtggatcgatggcgaagtcgtggtcctggccgagaac
ggcgcacccagcttccaggtcttgcagaatgccttcgacagcgagcgcactgccgatatc
gtcttctatgcgttcgacctgccttacctgggcgggcgcgacctgcgcggcgagccgctg
tcggtgcgcaggcattggctggaaaagctgatggcgcggtcccgcgatgaccatctgcgc
ttcagcgaggcattcgacgcggcgccatcgcagcttgccgccacggcctgcaagatgggc
ctggaggggatcatcgccaagcgccagtcgtcgcgctacgtctcgcgccgcagtcctgac
tggctgaagatcaagtgcgccaggcggcaggagttcgtcgtggtggggtacaccgccccc
aagggaggacgcagcggcttcggcgcgctgttgctggcggtgcatgatgcgcagggcggc
ttgcgctacgcgggccgggtcggctcgggcttcgacgccgccggtcttgcccgcatgaag
cagcagttggatgccttgcgtgccacggcgccgccgctccaggggccgacaggggcgggc
ggcggaatcacctgggtggcgccgcaactcgttgtcgaggtgtcgtttggcgagtggacg
tcctccgggcacgtgcgccaggcggtattccgcggcgtgcgcgaagacaagcccgcgcag
tcgatcacgaaggaggcgcccatggcagccaagcgtgcgaaagcggtcgcgaagaagacc
gtgcctgccaggcgccgcatccgcggcgcggcgccggaaggcgaggcgaagttgggcaag
ctgacccatcccgagcgcgtcatcgatccgtccaccgggctgacgaagctcgacctggct
cgctactatgggcaggtcgcaacgctgatcctgccgcaactgaagaaccgccccgtgtct
ttcctgcgggcgccgcagggcatccacgaggaacagttcttccagaagcacaaggaagcc
cggatccccggtgtgcgggacctgccgcgcagcctggatccggaccacgcgccgctgatg
gaagtgtccacgccccaggccttgttgtctgccgtgcagatgaacgtcgtcgagttccac
acctggaacgccagcaagacggtcatcggcaagccggaccgcctgctgttcgacctggac
ccgggcaagggcgtggcgtggcttgcggtgaaggaaggcgcggccctgctgcgatccctg
ctcgaggagatcggcctgcgggcctggctgaagacgagcggcggcaagggactgcatgtg
gtcgtgccgctgcggcggcaatacgagtggggcacggtcaaggatttctcggcggagatc
gtgcgccacctggcccggaccattccccaacgcttcgtcgccaagagcggcccccgcaac
cgagagggaaagatcttcgtcgactacctgcgcaacggcttcggcgccaccactgtcgcc
gcatggtccgcgcgggcgcggccggggctgggggtgtcggtccccatcggctgggatgag
ctcgacagcctggaaagcagcgcgcagtggacgatcgctgacatcgcggcgcgtctcgag
gtgggtaatgcgccctggtcggactacgcgccgcaggcgatcggccgggcgatgaaggcg
atgggcatggcatga

DBGET integrated database retrieval system