KEGG   Oenococcus sp. UCMA 16435: DSM07_01465Help
Entry
DSM07_01465       CDS       T05781                                 

Definition
(GenBank) HD domain-containing protein
  KO
K03698  3'-5' exoribonuclease [EC:3.1.-.-]
Organism
oen  Oenococcus sp. UCMA 16435
Brite
KEGG Orthology (KO) [BR:oen00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:oen03019]
    DSM07_01465
Enzymes [BR:oen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     DSM07_01465
Messenger RNA biogenesis [BR:oen03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     DSM07_01465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD TraI_2 tRNA_anti-codon CDC24_OB3 HDOD
Motif
Other DBs
NCBI-ProteinID: AZZ60084
UniProt: A0A3T0TN79
LinkDB All DBs
Position
complement(284909..285877)
Genome map
AA seq 322 aa AA seqDB search
MLNEHQKGENYSIYLLIKSAEKRMTSKSSPYIRLTLTDRSGEIQANLWDASDDDVANYVP
GKVVYLNVLQDEYQSKPQLKIQEIRLANETEPSDPSLYEISSPVSKKELQSQINDLLFQI
TNPTWNRIVRNVLNKYADKYYEYPAAEKIHHAYRGGLAFHSLSIAKLALAVSDLYPQINR
SLLLAGALLHDIGKTKELSGPVGTEYTTEGQLLGHIVIGDEIIVQAAEELGFDLDSEDML
ILRHLILSHHNKLEFGSPVQPKELEAYVLSKLDDLDSHIQLITTAIDKTSAGDFSEKIFA
ADNQPYYRLKTDLSEKSDQNNN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgaacatcaaaaaggtgaaaattatagtatttatcttttaattaagtcggct
gagaaacgaatgactagcaagagttctccttatattcgtttgactttaactgaccggtcc
ggcgaaattcaagctaatctttgggatgcaagtgatgatgacgttgctaattatgttccg
ggaaaagtcgtttatctaaatgttttgcaggatgaataccaatccaaaccacaattgaaa
attcaagagatcaggttagctaatgaaaccgaaccaagcgatccatctttgtatgaaatt
agctcgccggtctccaaaaaagaattacagtcgcaaattaatgatcttttgtttcaaatt
actaatccaacttggaaccgaattgttcgcaacgttttaaataaatacgctgacaaatat
tatgaatatccggcagctgaaaaaatccatcatgcttatcgtggtggattagcgtttcat
tcactttcaattgctaaattagcgttagcagtttcagatttataccctcagatcaatcga
tcgctgttattggctggtgctttattgcatgatattggtaaaacaaaagaactttcaggt
ccggtcgggacggaatatactaccgaaggacaattacttgggcatattgtaattggcgac
gaaattattgttcaagctgcagaagaacttggttttgatttggattctgaagatatgctt
atattaagacatttgattttgagtcatcataataaactggaattcggttccccggttcaa
ccaaaagaattagaagcttatgttttatcaaaattagatgatcttgactcgcatatacaa
ttgattacaactgctattgacaaaacttctgccggcgatttttcggaaaaaatttttgct
gccgataatcaaccttattatcgtctgaaaactgatttatcagaaaaaagcgatcaaaat
aacaattaa

DBGET integrated database retrieval system