KEGG   Oenococcus sp. UCMA 16435: DSM07_04435Help
Entry
DSM07_04435       CDS       T05781                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
oen  Oenococcus sp. UCMA 16435
Pathway
oen00970  Aminoacyl-tRNA biosynthesis
oen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oen00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DSM07_04435
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:oen03029]
    DSM07_04435
Enzymes [BR:oen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DSM07_04435
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DSM07_04435
Mitochondrial biogenesis [BR:oen03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DSM07_04435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AZZ60618
UniProt: A0A3T0TPS7
LinkDB All DBs
Position
complement(894995..896458)
Genome map
AA seq 487 aa AA seqDB search
MTDFFKENLTSLHKKLVDKEISSTELTKEALNKSKSSQSEINAFITIDDQGALKRAAEVD
AAGIDANNILSGIPFAIKDNIITKGLKTTAASHILDNFVPVYDATVIEKLNKLGIVTIGK
TNMDEFAMGGSTETSYFGKTANAWDHTKVPGGSSGGSASSVASGVIPAALGSDTGGSIRQ
PAAFNGIVGLKPTYGRVSRWGLIAFGSSLDQIGPLTRTVKDNARVLSAISGKDRRDTTSE
DQSVPDFTKGIEKGVKDLRIAVPKEYFASGIDEGVKDVVKKAIAKYESLGAKVDEVSLPH
SKYGIAAYYILASSEASSNLERFDGIRYGFSARKDDQTLEDLYVQTRSEGFGDEVKRRIM
LGTFALSAGFYDAYFKKAAQVRTLIVDDFTKVFENHDIILGPTTTSPAFDLGSENDDPVK
MYMNDLLTIPVNLAGLPGMSINAGFTAGLPVGLQIIGKRFDESTIYKTAYAFEQDSQLFT
KHPGVNF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttttttaaggaaaatttaacaagtttgcacaaaaaattagtcgataaagaa
atttcttcaaccgaactaacaaaggaagcccttaataagtcgaaaagctctcaaagtgaa
attaatgcttttatcacgattgatgatcagggtgctttaaagcgagctgctgaagtcgat
gcagccggaatcgatgctaataatattctgtccggtattcctttcgcaattaaagacaat
attattaccaagggtttaaaaacaacggctgcttcacatattctcgataattttgtaccg
gtctatgatgctactgttatcgaaaaattaaataaattgggaattgttacaatcggtaaa
accaatatggacgaatttgcgatgggtggttcaaccgagacttcttattttggtaaaact
gccaatgcttgggatcatacaaaagttcctggcggatcatcgggtggttcggcttcttcg
gttgcttcgggagtcattccggcggctctaggttctgataccggtgggtcaattagacag
cctgcagcatttaatggaatcgttggtttgaaacctacttacggtcgcgtatcgcgttgg
ggtttgatcgcttttggctccagtctcgaccagatcggtcctttaacgagaacggttaaa
gataacgctcgtgttttatctgcaatttccgggaaggatcggcgagatactacgagtgaa
gatcaatcggttcctgatttcacaaaggggattgaaaagggtgttaaggacttgcggatt
gccgttcctaaagaatattttgccagtggtatcgatgaaggagtcaaagatgtcgttaaa
aaggcaattgctaaatatgaatcattaggagcaaaagtcgacgaggtttctcttcctcac
tccaaatacggaatagccgcatactatattctggcttcgtcggaagcatcttctaatttg
gagcgtttcgatgggattcgttatggcttttctgctcgtaaggatgaccaaacgttggag
gatttatatgttcagactcgttccgaaggttttggcgatgaagtaaaacgacggattatg
ttaggtacctttgctttgtctgctggtttttatgatgcttatttcaaaaaagcggctcaa
gtgcgtactttgattgtcgacgattttacaaaagtttttgaaaatcacgatattatttta
ggaccgacaacaacttcaccggcttttgatctcggttcggaaaatgatgatcctgtcaaa
atgtatatgaacgacctgttgaccattccggttaatttggccggtttaccaggaatgtcg
attaatgccggctttactgccggtttgccagttggtctgcagattattggcaagcgtttt
gatgaaagtacaatctataaaacagcctacgcttttgagcaggacagtcagttgtttact
aagcatccgggggtgaatttctaa

DBGET integrated database retrieval system