KEGG   Oenococcus sp. UCMA 16435: DSM07_07580Help
Entry
DSM07_07580       CDS       T05781                                 

Gene name
cydC
Definition
(GenBank) thiol reductant ABC exporter subunit CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
oen  Oenococcus sp. UCMA 16435
Pathway
oen02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:oen00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DSM07_07580 (cydC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:oen02000]
    DSM07_07580 (cydC)
Transporters [BR:oen02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    DSM07_07580 (cydC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 MMR_HSR1 RsgA_GTPase SMC_N DUF2206 ABC_membrane NTPase_1 DUF87 AAA_29 AAA_16 Roc NACHT DUF815 NB-ARC FeoB_N AAA AAA_18 AAA_22 AAA_24 MgtE
Motif
Other DBs
NCBI-ProteinID: AZZ61162
UniProt: A0A3T0TRK5
LinkDB All DBs
Position
1531019..1532731
Genome map
AA seq 570 aa AA seqDB search
MKNKSDQWVRPFLKENRIGIFWTVVFSFLMIFSSMALMFTSGYLITRAAQHPSNIMLIYV
PIVLTRAFGIGRPTFKYAQRLTSHNWVLKIVSLTREKLFKTVDANSTIVAGEHSTGEVIS
LLSNDIDQLQNLYLRTIFPIASGILLYVFVTLFTAAFSLAFCLFWFIALMIIAICFPYFS
WKMNQDRILQQKKLADESIDLATDAVLGAFDWQLSGQQQKFTDQKKELSGRLAKVKSGGR
RFGWIRDFLIECILMVTVIVTLAWSYQQFFGHTVGIDLIAAFVLAIFPMSEALTDLNRGA
SEATYYRDSVERLNRLGPIKKQTVSQLHDNLRPNIKINNLSFAYNPKKEVLKEINMNIPF
GSKIAILGRSGVGKSTLLKLITGDLKSNQGNLAISGIEESQVKNSQNEIFSILDQNPYLF
DMTIANNLRLVDPNADDDRLTEVLKEVGLGKLLESLPDGLDTFMREAGSRFSGGEQQRFS
LARILLRDTPIVILDEPTVSLDPLTERQVMQTIFRVLKNKSLIWVTHHLIGLENVDKLYF
LENGKTKFSGTPLQSKQDPFLKKLWQLDEI
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaatctgaccaatgggtgagaccatttttaaaagaaaatcggattggtatt
ttctggacagttgtatttagttttttaatgattttttcttcgatggctttaatgtttacc
tcgggatatttaattactcgggcggctcaacatccgtccaatatcatgctgatatatgtg
ccgattgttttgacgagagcctttggaatcggtcgaccgacttttaaatatgcgcaaaga
ttgacgagccataattgggttttaaaaattgtatctttgactcgtgaaaaattatttaaa
acagttgatgccaactcgactattgttgccggcgaacattcaaccggtgaagttatttct
ttactttcaaatgacattgatcagttgcagaacctttatttacgaacaatttttcctatt
gccagcggcattcttttatatgtttttgtaactttatttacggcagcttttagtctggct
ttttgtctgttttggtttattgctttaatgattattgcaatttgttttccatatttttct
tggaaaatgaatcaggatagaattcttcagcaaaaaaaattagccgatgaaagcattgat
ttggcaaccgatgctgttttaggagcttttgattggcagctttccggccagcagcaaaaa
tttaccgatcaaaaaaaggaattatccggtcggttggcaaaagtaaaatcaggtggccga
cgctttggctggattcgtgattttttgattgaatgtattttgatggtaacggtaattgta
actttagcttggagttatcagcaattttttggacatacagttggaatcgatcttatagcc
gcatttgtcctggcgattttcccgatgtccgaagcattgactgatcttaatcgtggcgcc
agtgaagccacttactatagggatagtgttgaacgcttaaatcgtcttggcccaattaaa
aaacagaccgtcagtcaactgcatgataatttgcgtccgaatatcaaaattaataatttg
tcttttgcttacaatcctaaaaaggaagttttaaaggaaattaatatgaatattcctttc
ggaagcaaaatcgctattcttggccgctctggggttggtaagtcaacacttttgaaactg
attaccggtgatctaaagagtaatcagggaaatttggctatttccgggatcgaagaatca
caagttaaaaattctcagaatgaaattttttctattcttgaccaaaatccttatcttttt
gatatgactattgccaataatttgcgtttggtcgatccaaacgccgatgatgatcgttta
acggaagtcttaaaagaggtcggcctgggaaaattattagaaagcctgccggatggtttg
gatacttttatgagagaagcaggcagtcgcttttctggtggcgagcagcagcgtttctcc
ttagcgaggattttattaagagatacaccgattgtgattttggatgagccgactgtaagt
cttgaccctttaaccgagcgacaggtcatgcaaactatttttcgtgttttgaagaataaa
agtctgatctgggtaactcatcatttaattggtttggagaatgttgacaaattatatttt
cttgagaatggaaagacaaaattctcgggaactccgttacaatcaaaacaggatccattt
ttaaaaaaactttggcaacttgacgaaatttaa

DBGET integrated database retrieval system