KEGG   Olea europaea var. sylvestris (wild olive): 111365449Help
Entry
111365449         CDS       T05244                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00020  Citrate cycle (TCA cycle)
oeu00190  Oxidative phosphorylation
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
oeu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111365449
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111365449
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111365449
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 111365449
NCBI-ProteinID: XP_022841764
LinkDB All DBs
Position
17
AA seq 631 aa AA seqDB search
MWRCVSRGLRIPSKKSTDCNSLRRLFSTQSNVGGSSYTVVDHTYDAVVVGAGGAGLRAAI
GLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDA
IQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLNFGKGGQAYRCACAADRTGH
ALLHTLYGQAMKHNTQFFVEYFALDLLMGKDGSCQGVIALNMEDGTLHRFRAPSTILATG
GYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRGEGGI
LRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVLK
ERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHYGEVVTIKDDDPDAVIPGLL
AAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIRRPGESQKPLEQDAGERTIAWL
DNLRNSNGSLPTSNIRLNMQRIMQSNAAVFRTQETLEEGCQLIDKAWESFHDVKLKDRSL
IWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTLLQKRDDENWMKHTLGYW
ENEKVRLAYRPVHMNTLDDEVESFPPKARVY
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtgtcgcgtggcctccgcattccatcgaagaaatctacggactgcaac
tccctccgacgcctcttttcaactcaatccaatgttggagggtcatcatacacagtggtg
gatcatacctatgatgctgttgtggtgggcgcaggtggtgcaggcctgcgagcggcaatt
gggttgtccgagcatggattcaatacagcttgcattaccaaactatttcctactcggtcc
cacactgttgcagctcagggtggaataaatgctgcattaggaaatatgaccgaagatgat
tggaggtggcacatgtatgatacagttaagggaagcgattggctaggtgatcaggacgcc
attcagtacatgtgtagggaagcaccaaaagcagttatagagcttgaaaattatgggcta
ccattctccaggactgaagatggaaagatttaccaacgtgcatttggtggtcaaagccta
aactttggaaaaggtggacaagcatatcgttgtgcatgtgctgcagatcgaactgggcat
gctttgttgcatactctttatggccaggctatgaaacacaatacacaattttttgtggaa
tactttgccttggatttacttatgggtaaagatggtagctgccaaggtgtaattgccttg
aatatggaggatgggacattacataggttccgtgctccatcaacaattctagctacaggg
ggttatggtagggcatacttctctgctacctctgctcacacttgcactggagatggaaat
gctatggttgctcgagctgggctgcctcttgaggatctggagttcgtccagttccatcca
acgggtatatatggtgcaggttgtctcattactgaagggtctaggggtgaaggtggcatt
cttaggaatagtgaaggtgaaagattcatggaacgttatgccccaacagctaaggatctt
gcatcaagagatgttgtttcgagatctatgacgatggagatccgggaaggacgtggtgta
ggacccttgaaagatcacatctatcttcacttaaatcacttacctcctgaggttctcaag
gagagacttcctggtatatctgaaactgctgctatttttgctggtgtcgatgttacaaaa
gagccaatccctgttttacctactgtccattataacatgggtgggatccccacgaatcat
tatggagaggtggttaccatcaaagatgatgatccagatgcagtgattcctggactttta
gctgctggggaagctgcctgtgcatctgttcatggcgctaatcgacttggtgcaaattct
cttcttgacattgttgtatttggacgggcttgtgcaaacagggttgctgagatccgtaga
ccaggagagagtcaaaaaccactggaacaggatgctggagagagaactattgcatggttg
gacaatcttagaaattcaaatggttcccttcccacctcgaatatccggttgaacatgcaa
cggattatgcaaagcaatgctgctgtatttcgcacacaagaaacattagaagaaggttgt
cagttgattgataaagcatgggagagctttcatgatgtcaagttgaaggacagaagcttg
atatggaactcagacttgatagagactattgagttggaaaaccttttaattaatgcatgt
atcactatgcactctgctgaagcgaggaaagaaagtagaggagcccatgcacgtgaagat
tttacgttgttgcagaaaagagatgatgaaaactggatgaaacatactttgggatattgg
gagaacgaaaaggttaggcttgcctacaggccagttcacatgaatacgctggatgatgaa
gtggagtcatttcccccaaaggcccgagtatattaa

DBGET integrated database retrieval system