KEGG   Olea europaea var. sylvestris (wild olive): 111367372Help
Entry
111367372         CDS       T05244                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: DNA ligase 6-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu03030  DNA replication
oeu03410  Base excision repair
oeu03420  Nucleotide excision repair
oeu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    111367372
   03410 Base excision repair
    111367372
   03420 Nucleotide excision repair
    111367372
   03430 Mismatch repair
    111367372
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oeu03032]
    111367372
   03400 DNA repair and recombination proteins [BR:oeu03400]
    111367372
Enzymes [BR:oeu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     111367372
    6.5.1.6  DNA ligase (ATP or NAD+)
     111367372
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     111367372
DNA replication proteins [BR:oeu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    111367372
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     111367372
DNA repair and recombination proteins [BR:oeu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     111367372
   NER (nucleotide excision repair)
    Other NER factors
     111367372
   MMR (mismatch excision repair)
    Other MMR factors
     111367372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DRMBL RNA_ligase RMMBL UBA_4
Motif
Other DBs
NCBI-GeneID: 111367372
NCBI-ProteinID: XP_022843972
LinkDB All DBs
Position
18
AA seq 1248 aa AA seqDB search
MSSSEPPEPLSLSSTGLYNTAISSFSLPSQSSPSRPLTTPPSSLSHSKLIPKTRFIVDGF
KNADSNFSVSYFLSHFHSDHYTGLTPQWSEGIIYCSSITARLLHQILKIPQAFIFPLPLS
LPLFIDGSEVSLIDANHCPGAVQFLFKVPVHSKSRGDDYDEGNNNVIKFEKYVHTGDFKF
AVRTMDSFDIHLVPYSEHSNYNELREYVKFLKPKRVIPTVGSDVEKIGSKHADAMQKHFA
GLVDEMAIKQEFLMGFLRCGPQEVNPKIEKDPASALDNFPVQEDEGTLSAPNCCNDIEVV
GDMKSSFPQHELGSPDLVPLKEKEREKSVQELEDCLPSWVPRRQMLDLLGDSGGDVVEAV
SNFYEHEIEFHNLALACTSVSGTFQASAEHEPALPFESLPVKSVRIDAEVSCTQSYVSSG
PVKLNKSGISPGKRKRNLDSKATKRTXTNPIQSSGGSKQYTITRFFGKQMPVVSEDSKVG
TAFNLCNDDQSRSIDDATEPYKEEVDQFIQVVNAGEQLRSYAATILEKAKGDINTALDIY
YSDYTGIVNEKIGRLPESNELIKSECSSRICSDKNADLSQSDKVGNKSGISFAAQPTDSG
NYLLLPPERYSPIEHACWRKGQPAPYIHIARTFDLVEDEKGKLKATSMLCNMFRSLLALS
PEDVLPAVYLCTNKIAPDHENMELNIGASIVVAALEEACGTNRSKISNLYNSLGDLGDVA
QLCRQTQSLLAPPPVLTIQGVYSVLQKISVQTGSGSTIRKKSLIMNLMRSCREKEMKFIV
RTLVRNLRIGAMMRTVLPALAQAIVFNSADTETGCLKDHLQRLSGAVVEAYNVLPNLDLL
IPCLMKMGVKFSSSTLSMVPGIPIKPMLAKITNGASQVLKLFQNKAFTCEYKYDGQRAQI
HRLPDGLIHVFSRNGDETTSKFPDIINIIKETCPGVVTFVLDAEIVAIDRKNGLKLMSFQ
ELSSRERGSKDSLIAVDKIKVDICLFIFDIMLANGDKLLDLPLRQRRKYLKNLFGDGKPG
YLEYAREMTVEAEDSDANNEATLNKMNNFLDDALRSSCEGIMVKTLDVNAGYTPSKRSDT
WLKVKKDYIEGLSDSLDLVPIGAWHGNGRKAGWYSPFLMACYNPDTEEFQSVCRVMSGFT
DAFYTQMKEFFSGDKILSKKPPYYRTAEVPDMWFSPQLVWEIKGADLTVSPVHHAAIGLI
HPSRGISIRFPRFIRSVLDRIPEECSTSADIVDMFHSQTRKMDVSGKE
NT seq 3747 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctccgaaccgccggaaccgttatccctatcctccactggtctttacaatacc
gctatctcctccttctccctgccatcgcaatcgtcaccatctcgtcccctcaccactccc
ccttcctccctctcccactctaaactcatccccaaaacccgctttatagtcgacggtttc
aaaaacgccgattccaatttctccgtttcatactttctctcccacttccactcggaccat
tacacaggcctcacgccgcaatggtccgaaggcatcatctattgctcctccatcaccgct
cgcctcctccaccaaatcctcaaaattccacaagccttcatttttccgttacctctatct
ctacccctttttattgatggctcggaagtttcccttatcgacgccaatcactgccccggt
gcggttcagttcttatttaaagtcccggtgcatagtaagagtagaggtgatgattatgat
gaaggtaataacaatgttattaagtttgaaaaatatgttcatactggtgattttaaattt
gcggtgaggacgatggattcatttgatattcatcttgttccctatagcgagcattcaaac
tacaacgagctcagggagtatgtgaagtttttgaagccgaagcgggttattcccactgta
ggttctgatgttgagaaaattggtagcaaacatgctgatgcaatgcagaagcattttgct
ggtttggttgatgaaatggccatcaagcaagaatttttgatgggtttccttcgctgtggg
ccccaggaagtgaatccaaagattgagaaagatcctgcttctgctttggacaatttccca
gtgcaggaggatgagggcactttgtctgctccaaattgttgcaatgacattgaagtggtg
ggtgacatgaaatcttcatttcctcagcatgaacttggttcccctgatttagtgcccctg
aaagaaaaagagagagagaaatctgttcaggaacttgaagactgcttgcccagttgggtg
cctcgacgccagatgttggatttacttggtgattcaggtggagacgttgttgaagcggtt
tctaatttttatgaacatgaaattgaattccataatctggccctagcttgtacatctgtc
tccggtactttccaagcaagtgcagaacatgagcctgctttgccctttgaatcacttcct
gttaagagtgtgcgtattgatgcggaagtttcttgcactcagagctatgtatcatctggc
cctgtaaagttaaataagagtggaatttctcctggaaaaagaaagagaaatcttgatagc
aaggcaacaaaaagaacatgaacaaatccaatccagtcctctggtggttcaaagcagtat
accataacaaggttctttggtaaacaaatgcctgttgtctctgaagatagtaaagttgga
acagcgtttaatctatgtaatgatgatcaaagtaggtctattgatgatgctactgagcca
tacaaagaagaggtggatcagtttattcaggttgtaaatgctggtgaacaattaagaagc
tatgcagccaccatcctcgagaaggctaagggagacatcaatacggctcttgatatatat
tatagtgattatactggtattgtcaatgagaaaataggcaggttgccagaaagcaatgaa
ttgattaaatctgaatgttccagtagaatttgttccgacaaaaatgctgatctatcacaa
agcgataaagtgggaaataagtctggtatttctttcgctgcccaaccaacggattctggg
aattatttattactacctcctgagagatattctccaatagagcacgcttgctggaggaaa
ggacagcctgctccatacatacatatagcacggacttttgatctagttgaggatgaaaag
ggcaaactaaaagctacatcaatgctatgcaatatgtttaggagcttgctggccctttca
cctgaggatgtgctgcctgctgtttatttgtgcacaaataagattgctcctgaccatgaa
aatatggaactgaatattggtgcaagtattgtagttgcagccctggaagaggcatgtggg
acaaacaggtctaaaataagcaatctttataacagccttggcgatcttggtgatgttgct
caactttgccggcaaacacaatcactacttgcccccccaccagttcttacaattcaagga
gtgtattcagttctccaaaagataagtgtgcaaacaggtagcggcagtacaatccggaag
aaaagtctcattatgaatctcatgcgttcatgtcgagagaaggaaatgaaattcatagtc
agaactttggttagaaatttaagaattggagctatgatgagaactgtacttcctgcattg
gctcaggctatcgtgttcaattctgctgatacagaaactgggtgtttgaaggatcatctt
cagcgcctatctggagcagtagttgaagcatataatgtacttccgaacttggatttactt
atcccttgcctaatgaaaatgggggttaagttctcttcatcaaccttgtcaatggttcca
ggcataccgatcaaaccgatgcttgcaaaaattactaatggagcctctcaagtattgaag
ctcttccaaaacaaggcatttacatgtgaatacaaatatgatggccagcgagctcaaatt
cacagattacctgatggtttgatacatgttttctcgaggaatggtgatgaaaccacgtca
aaattccctgatataataaacataattaaggagacatgtcctggagtagtaacatttgta
ctagatgcagagatagttgcaattgataggaagaatggcttgaagctcatgtcattccaa
gaactgtcttccagggagagagggagtaaggattccctgattgctgtagacaaaataaag
gtcgacatatgcctctttatcttcgacatcatgttggcaaatggagacaagctgctggat
ttacccctccgtcaaagacgaaaatatttgaagaacttgtttggtgacgggaaaccaggc
tatttagaatatgcaagagaaatgacagtggaagcagaagattctgatgcaaacaacgaa
gccacattgaataagatgaacaactttcttgatgatgcacttcgttcctcctgtgaaggc
ataatggttaaaactcttgatgtaaatgctggttatactccgtcaaagcgttcagatacg
tggttgaaggtcaagaaagattacattgaaggattgagtgattccttggacttggtccct
attggtgcttggcatggaaatggaagaaaagcaggatggtatagtccattcctaatggcc
tgctataatcctgatactgaagaattccagagtgtctgccgtgtcatgtctggatttacc
gatgctttctacacacagatgaaggagttcttctccggggacaaaatcctttctaaaaaa
ccaccatattatcgaactgctgaggtgcctgatatgtggttttctcctcaacttgtctgg
gagataaagggtgctgacctcacagtgtcaccggttcatcatgctgccattggtttaatc
catccatctcgtggtatctcaatcagatttccgagatttattcgctctgtcttggataga
atccccgaggaatgtagcacatctgcagatatagttgacatgttccattctcagactagg
aagatggatgtgagtggcaaagagtga

DBGET integrated database retrieval system