KEGG   Olea europaea var. sylvestris (wild olive): 111375395Help
Entry
111375395         CDS       T05244                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF-like
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    111375395
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oeu03036]
    111375395
Enzymes [BR:oeu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     111375395
Chromosome and associated proteins [BR:oeu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     111375395
   Polycomb group proteins
    PRC2-EZH2 complex
     111375395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: preSET_CXC SET TCR
Motif
Other DBs
NCBI-GeneID: 111375395
NCBI-ProteinID: XP_022853984
LinkDB All DBs
Position
Unknown
AA seq 898 aa AA seqDB search
MSESKASPSASGSDPPTTGHQESLLSTQEILAVIDSFKKQVALDRCVSIKKHMEENTQKV
ADVTKSLLRLSMERSNLKIIGADKSVDLLSKRQKDAIDMHNGIGTSNGDNDSSSSQEDGY
GSSAILLGSSIAVKNAVRPITLPEVKKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQN
GGEALICSDSEEEANDDEEEKKEFADFEDYILRMTIKEVGLSDSALDLLAQCLCRKSSEI
KARYEDLFKSENATCDVNNGNIDGFVNPYIDKDLDAALDSFDNLFCRRCLVFDCRLHGCS
QDLIFPAEKQLPWSCPEVEKKPCGPNCYRQAIHEEKAVTASDNAAAVHIQKRKQGGPSVH
KKSKSCPSESASSNAKDISESSDSEIKLINDVPSIPKCKSIGKCGGNKRNSKRIAEHVLV
AIRKKQKKIAASDSESVASGSLGSKDMNLQAPRRESNGTSSQKLKSSSSRKSSRKEPLAP
DSNKSLQGDAPSGASNEIESKRPVTSSDDTLKKEEFIGESTYKQEVTDDKCWKAFEKALY
EKGLLIFGRNSCMIARNLMNGLKTCSEVFKYMHHSENKQFFRPCDGVTFTDGYLKADGSE
ILGNAARRRSRFLRRKGRVRRLKYTWKSAGYHSIRKRISERKDQPCRQYNPCGCQSACGK
ECPCLVNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWIS
CGDGTLGVPSQRGDNYECRNMKLLLKQQQRVMLGRSDVSGWGAFLKNNVGKHEYLGEYTG
ELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFANHAPDPNCYAKVIMVA
GDHRVGIFAKERICSGEELFYDYRYEPDRAPAWAKKPETSGAKREDCAPSNGRAKKHT
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagtccaaagcttccccatccgcctccggatccgaccctccgactaccgggcat
caagaaagtcttctgtcaacccaagaaatactagcagttattgattcttttaagaaacag
gttgctttggatcgttgtgttagcataaagaaacatatggaagaaaatacacagaaagtg
gctgatgtcacaaaaagtcttcttagactatcgatggaaagaagcaatcttaagattatt
ggtgctgacaaaagtgttgatttactgtctaagaggcagaaagatgcaattgatatgcat
aatggtattggtacgagtaatggggataacgatagcagtagctctcaagaagatggatat
ggctcatcggcaattcttttaggatctagtattgcagtcaagaatgctgttcgtcctatt
acactgccggaagtgaaaaaattaccaccatatacaacatggatttttttggatagaaat
caaagaatgacagaggaccagtcagtagtcggcagaaggagaatttattatgaccaaaat
ggtggcgaggctctaatctgtagtgatagtgaagaagaagccaatgacgatgaagaagag
aagaaagagtttgctgattttgaagattatattctgcgaatgactattaaagaggtgggg
ttatctgattccgcattggatttgttggcgcagtgcttatgtagaaaatcttctgaaatc
aaggcaagatatgaagatctttttaagagcgagaatgccacatgcgacgtgaacaatgga
aatattgacggctttgtgaatccttatattgataaagatctagatgcagctctggattca
tttgacaatctgttttgtcggcgctgtcttgtttttgattgcagactgcatggttgttcc
caggatcttatatttcctgctgagaaacaactaccatggtcctgtccggaggtggaaaaa
aaaccatgtggcccaaattgctaccgtcaggctattcatgaagaaaaagctgtcactgca
tccgataatgctgctgccgtgcatatacaaaagaggaagcagggaggtccatctgtacac
aagaagtcaaagtcttgcccgagtgaaagtgcttcttcaaatgcaaaagacatatctgaa
agcagtgactcagaaatcaaactcattaacgatgttccttctatacctaagtgtaaatct
ataggaaaatgtgggggaaacaaaaggaatagtaagagaatagccgagcatgttttagtt
gccataaggaaaaaacagaagaaaattgctgcttcagactctgaatctgttgcaagtggg
agtctcggttctaaagatatgaatcttcaagctcctcgacgagaaagtaatggcactagt
tcacagaaattaaaatcttcgagttctaggaagtctagtaggaaagagcctttagctccg
gacagtaacaaatctttgcagggggatgctcctagtggggcatcaaatgagattgagagt
aaacgacctgtgactagtagtgacgataccttaaagaaagaagaatttattggcgagagt
acgtataaacaagaagtaactgatgataaatgttggaaagcatttgaaaaggcactatat
gagaaggggcttctgatttttggccggaacagctgtatgattgctagaaatctgatgaat
ggtctgaagacatgttcagaggtttttaagtatatgcatcactctgagaataagcaattc
tttcgaccttgtgatggagtgacctttactgatggctatttgaaagctgatggtagtgaa
atcttgggcaatgctgcacgtagaagatctagatttttacgtaggaaaggtagggttcgt
cgcttgaagtacacgtggaaatctgcaggataccattctatcaggaagcgcatttctgag
aggaaagaccagccttgtcggcagtacaacccttgtggatgtcaatctgcctgtggaaaa
gagtgtccatgtcttgttaatggtacctgctgtgagaagtactgtgggtgtccaaagagt
tgcaaaaatagatttagaggctgtcactgtgccaaaagtcagtgtcgaagtcgtcagtgc
ccctgtttcgctgctgatagagagtgtgatccagatgtttgtcgaaattgctggatcagt
tgcggtgatggcaccctcggggttccttctcaaagaggtgataattatgaatgcaggaat
atgaagcttcttctaaaacaacagcagagggtaatgctgggaagatcagatgtttctggt
tggggagcattcttgaagaataatgtgggcaaacatgaataccttggagagtacactggt
gaactaatatcacaccgtgaagctgataaacgtggcaagatctatgaccgggagaattct
tcgtttctctttaacttaaatgaccagtttgttctagatgcttatcggaagggtgataaa
ttgaagtttgccaaccatgctcccgatcctaactgttatgctaaggtcattatggtggcc
ggagatcacagggtgggtatatttgcaaaagaacgaatttgttcgggcgaagaactcttt
tatgattatcgttacgagccggatagagctcctgcttgggcaaaaaaacctgagacatct
ggtgctaaaagagaagattgcgctccttctaatggtcgtgcgaagaagcacacctga

DBGET integrated database retrieval system